SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000120547 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000120547
Domain Number 1 Region: 32-236
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.1e-36
Family DnaQ-like 3'-5' exonuclease 0.0000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000120547
Sequence length 688
Comment (Mus musculus)
Sequence
MATKRLARRLGLIRRKSVTPASGNPGGSRLKQLYAYLIVVDFESTCWNDGKHHSSPEIIE
FPAVLLNTATGEIESEFHAYVQPQEHPILSEFCTELTGIKQVQVDEGVPLKICLSQFCKW
IHKLQQQQTISFAAGDSEPSTSEVKLCAFVTWSDWDLGVCLEYECRRKQLLKPVFLNSWI
DLRATYRLFYKRKPKGLSGALQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCLMKITR
SLNKVLTKKNPKILARNLGTDQVEEAATCNMSIQGPSIYQKELQSTVNAEENAQMNSVCV
NSSCIKGQLQPKSNMKADLYNIRHSFPLFTTKSSTSVDQLHSPTLNPPLTMQKPSKSDQL
ALNDSSKSSTLNSNLVLVSTTIPSVNHVSDVEMGHTFDCLPMLAEWEDVVLLPASQAEPD
TDCMPPVSDTNVSTSLNSAERSLVPEEPETLSYENFEDLQETPQNSETSKSIVYKSPHST
VYDVKGAKHPGSDASAFKLPKCKPFPFTSVHASAAYPSVLRKDPLLSGGTKRNSLSPPAS
PRTKRQTFTIHEEKPTSSICSPGTTSCRVSPSVLTSTVNLQEPWKTGKMTPPLCKCGRRS
KRLIVSNNGPNHGKAFYCCPVGKYQQDRKCCGYFKWEQTLQKERTNGKALSHSSEGLTFS
SPETSRIHDRNLSFPIKNSLRLRPSMRH
Download sequence
Identical sequences Q5BKS4
ENSMUSP00000120547 ENSMUSP00000120547 NP_081974.3.92730 ENSMUSP00000120547 10090.ENSMUSP00000120547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]