SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000123171 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000123171
Domain Number 1 Region: 81-328,630-648
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.74e-34
Family Calpain large subunit, catalytic domain (domain II) 0.01
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000123171
Domain Number - Region: 784-853
Classification Level Classification E-value
Superfamily Globin-like 0.000347
Family Globins 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000123171
Sequence length 1657
Comment (Mus musculus)
Sequence
MASKQAKRKEVHRINSAHGSDKSKDLYHFGSNVPPGSFEQKKGKFPIWPEWSEADINAEK
WDAGKGGKEKDKTAKSPIFHFFEDPEGKIELPQSLKVFSWKRPQDFIFSRTPVVVKNEIT
FDLFSPNEHLLCSELMRWIISEIYAVWKIFNGGILSNYHKGNLGELPILPWKPWEHIYSL
CKAVKGHVPLFNSYGKYVVKLYWMGCWRKITVDDFLPFDEENNLLLPATSYEFELWPMLL
SKAIIKLANVDVHVAHRRELGELTVIHALTGWLPEVIPLHPAYVDRVWELLKEILPEFKL
TEEPSSESKITTIDNKLKEATKENKDGKDGKNGKDLKDGKDMKDGKDGKDGKDGKDGKDG
KDEKADARDLGKKNKKDGEKEKEKFKFSLHGSRPSSDVQYSMQSLSECSSAIQLPHMVVY
ATFTPLYLFENKIFSLEKMANSAEKLREYGLSHICSHPVLVTRSRSCPLVSPPKPPPLPA
WKLIRHKKETVITDEAQDAVPKKPEQFLEISSPFLNYRMTPFTIPTETHFVQSVIKKGTP
LGSSLPPLVENDLVASTSQGEMSIVNGNQSQGNIALQITLGKDEPSEPALADFHQLEATS
LDRDLISLTTATLDKSQEELAINEGVAKEIWLDFEDFCVCFHHIYIFHKPHSYCLNFQKS
EFKFVEERVPYYLFVDSLKPIELLVCFSALVRWGESGALTKDSPPVEPGLLTAEAITWKS
LKPLSVVLRIHTYATKASVVRLPAGRHMLLFNAYSPVGHAIHVCSMTTFVIGDEDIVLPN
FEPESYRFTEQSIIIMKAIGNVIANFKDKGKLPAALRDLQAAHYPIPLNNKELTAQHFRV
FHISLWRLMKKSQVAKPPSNFKFAFRAMVFDTDLLDSFSEDVSLAEWVDLKYSTPINEKE
YTSEEIAAAVKIQSMWKGCYVRLLMKARKPETKENVTVADTLQKIWAVLEMNLEQYALSL
LRLMFKSKCKSMESYPCYQDEETKLAFADHTVNYADQPPNSWFIVFREIFLVPQDMIILP
KVYTTLPICILHVINNDTLEQVPKVFQKVVPFLYTKNKKGYTFVAEAYTGDTFVSGARWK
LRLIGSYNPLPFLARDSPCNTFSIKEIRDYYIPNDRKILFRYSIKVTVAQSITIQVRTSK
PDTFIKLQVLESEEVITSTVGKGQAVIPAFYFLGNEKALSSQSSKQVLLSHPSPKKDPEV
LTKKKSGQPGQKSFKGRSGGGLTDTGMPLLEEEILNIPTLEENSSTPQQCYKYIIQCLVL
FNSWPLNETQLTFVQALKDMEKMDIKEKHEEPAPMGSPDSHAVSEGQKSVGVPKTTRKGK
EKSAEKEKLAKEKQAPRFEPQQVQMPTAVHSQQEDPNKPYWILRLVSEHTDSDYVDVKKD
TERADEIRAMKQAWETTEPGRAIKAAQARLKYLTQFIKKPVTTDTTTSAPSPETLSVSQS
QTKSSEEGELDTGKYADIKELPPNAAGSVLWKKWQMTKTITSLTKFTSSESVPKEEPPQK
EIPVVRQRSPTILETSPQQIRKALEFLDFSHYVRKTAAEAVLQTEELNKQQAMQKAEEIH
QFRQHRSRILSIRDIDQEERFKQKDEVLEMYGEMRDSVDEARQKILDIREVYRNKLLEAE
RLRMEALAAQEAAVKIEIEKKSPASDSQKKKKVGKKK
Download sequence
Identical sequences G3UZ78
ENSMUSP00000134378 10090.ENSMUSP00000123171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]