SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000005023 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000005023
Domain Number 1 Region: 207-471
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.03e-67
Family Nuclear receptor ligand-binding domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000005023
Sequence length 472
Comment (Rattus norvegicus)
Sequence
MAGEDHPWQGSILYNLLMSAKQKHGSREEREVRLGAQCWGCACGTQPVLGGEGLPGGQAL
SLLYRCCFCGENHPRQGGILYSMLTNARQPSGATEAPRARFRAPCWGCACSSAEPLVGRE
GLPAGQVPSLLYRCCFCGEEHPRQGSILYSLLTSAQQTHVSREVPEAHRGGEWWQLSYCT
QSVGGPEGLQSTQAMAFLYRSYVCGEEQPQQSSVASDTPVRADQTPAAPQEQPRAPWWDA
SSGVQRPIALKDPQVVCEAASAGLLKTLRFVKYLPCFQILPLDQQLVLVRSCWAPLLMLE
LAQDHLHFEMMEISEPNLMHEMLTTRRQETEGPEPADPQATEQPQTVSAEAGHVLSVAAV
QAIKSFFFKCWSLNIDTKEYAYLKGTVLFNPDLPGLQCVKYIESLQWRTQQILTEHIRLM
QREYQIRSAELNSALFLLRFINTDVVTELFFRPIIGAVSMDDMMLEMLCAKL
Download sequence
Identical sequences G3V6H3
ENSRNOP00000005023 ENSRNOP00000005023 10116.ENSRNOP00000005023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]