SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000006272 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000006272
Domain Number 1 Region: 232-274
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000034
Family Spermadhesin, CUB domain 0.0079
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000006272
Domain Number - Region: 556-592
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0288
Family Spermadhesin, CUB domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000006272
Sequence length 833
Comment (Rattus norvegicus)
Sequence
MARSACGFSVALLGTLLLGTACLLRGTEASEIALPRGSDITVHIKLVSPALPVKFCYIVV
SRQHVTELTIRPGERKSFTFSCNNPEKHYVLKIEKNIDCMSGPCPFGEVRLQPSKSELPI
LNRTYIWDVRAHKSIGLELQFATPRLRQIGPGESCADGVTHSISGHIDATEVRIGTFCSN
GTVSRIKMQEGVKMALHLPWFHPRNISGFSIANRSSIKRLCIIESVFEGEGSATLMSANY
PGGFPEDELMTWQFVVPAHLRASVSFLNFNVSNCERKEERVEYYIPGSTTNPEVFRLEDQ
QPGNMAGNFNLSLQGCDQDAQSPGILRLQFQVLVQRPQNESNITYMVDLSQERTMSLTIE
PRPVKHGRRFVPGCFVCLDSRTCSTNVTLTAGSKHKISFLCDDLARLWMNVEKTLSCLDH
RYYYGKSFNLQVPKDILQLPVQLHDFSWKLLVPKDRLGLMLVPGQKLQQHTRERPCNTSF
GYQVASTTPGQDLYFGSFCPGGSIEKIQVKQNSSVTLRTYAPGFQQEVSKQVLTVSLIPY
FKEEGIFTVTPDSKNKVYLRSPNWDRGLPALSSVSWNISVPSNQVACLTFFRERSGLACQ
SGRAFMIIQEQQTRAEEIFSLEEEVLPKPSFHHHSFWVNISNCSPMNGKQLDLLFWVTLT
PRTVDLTVIIGAAGGGALLLFALGLIICLVKKKKKVDKGPAVGIYNGNANTQMPQTQKFQ
KRRKDNDSHVYAVIEDTMVYGHLLQDSGGSFIQAEVDTYRPFQGPMGDCPPTPPPIFSRT
PTAKFTADKLAPSSPPESESEPYTFSHPNKGEVGVRDTGIPLLNIQGPMETEE
Download sequence
Identical sequences D3ZVA1
ENSRNOP00000006272 ENSRNOP00000006272 NP_001100339.1.100692 NP_001100339.1.4139 10116.ENSRNOP00000006272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]