SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000009059 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000009059
Domain Number 1 Region: 41-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.95e-39
Family SCAN domain 0.0000402
Further Details:      
 
Domain Number 2 Region: 484-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 3 Region: 586-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.49e-18
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 401-443,470-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5e-17
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 233-290
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000314
Family KRAB domain (Kruppel-associated box) 0.0037
Further Details:      
 
Domain Number 6 Region: 540-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000218
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000009059
Sequence length 643
Comment (Rattus norvegicus)
Sequence
MATALELEDQDLWEEEEEGVLMVKLEDDFTCGPESALQGDDPVLETSHQNFRCFRYQEAS
SPREALIRLRELCHQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAV
TLVEGLQKQPRRPRRWVTVHVQGQEVLSEETLHLGVEPESSNEQQEPTQTLTAEQPHEEA
LRSTDLGTLEQESLQHEGERLPLLESEVPVSQHADLPTEQGSGHPEMVALLTALSQGLVT
FKDVALCFSQDQWSDLDPTQKEFYGEYVLEEDCGIVVSLSFPIPRLDDPSQIREEEPQVP
GVHESQEPAEPEILSFTYTGDMSEAEEECVEQQDTNKSILANTEIHQTPDWEIVIEDNTS
RLNERFGTNVSKVNSFTNIRKTMPVHSQSGRQHHCPLCAKSFTCNSHLIRHLRTHTGEKP
YKCMECGKSYTRSSHLARHQKVHKVNTPHKHPPNRKTVDASQVQSEATTRVEKPYTCDDC
GKHFRWTSDLVRHQRTHTGEKPFFCTICGKSFSQKSVLTTHQRIHVGGKPYTCANCGENF
SEQKQYLAHRKTHVSEENHLCSECGRSFNHSAAFAKHLKGHASVRNCRCDECGKSFSRRD
HLVRHQRTHTGEKPFTCATCGKSFSRGYHLIRHQRIHTGKTKT
Download sequence
Identical sequences D4A7G1
ENSRNOP00000009059 10116.ENSRNOP00000009059 ENSRNOP00000009059 NP_001102760.1.100692 NP_001102760.1.4139 XP_017451317.1.100692 XP_017451318.1.100692 XP_017451319.1.100692 XP_017451320.1.100692 XP_017451321.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]