SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000009118 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000009118
Domain Number 1 Region: 848-1054
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.13e-49
Family DBL homology domain (DH-domain) 0.0004
Further Details:      
 
Domain Number 2 Region: 1216-1402
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-26
Family Pleckstrin-homology domain (PH domain) 0.00000672
Further Details:      
 
Domain Number 3 Region: 1043-1163
Classification Level Classification E-value
Superfamily PH domain-like 1.74e-24
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000009118
Sequence length 1406
Comment (Rattus norvegicus)
Sequence
MTSAVELKKPPLAPKPKLVGTNNKSPPPPIAPKPDIGNASVPRLTKTKPAIAPKPKVLTN
SDVQDVKDQPSKKLTLNLEEREPELPESTGKFNCKDVGDAHGDYIFPTCSCSSGCTHEPR
TRENLCAEQLVLEPLGMKEHLENGKNGESSKRGSRWNSSREKCRSQSGVVLKASIFEEKL
KEVLTQPRSRSPSSSPRKHRCPNKPEMNGDHSCARQVRIEFADTSSSQSSFGKAPHSCHT
QPPRDKSQNLQTCQDGSAESLGPFHSCELEGKRGCSGGTSQKSEVQGLGPVEIHLLPYTS
KFPTPKPRRTHAARLRRQKHVDTPSESTEEPESSNNGSSCLHEDSLKNNKVSVLHQNALS
NQGPVDEVRPGNKKALTRESNSDRQDSVSSQKAVQHETSSFEKVAPSLDTDSSLTSDSTV
EDGSDVLPAVDRETAFIQCSPQPLSLPKQVKLACAEQQPTTCNREVSVPQIQKESSSRIV
PKKPQRHSLPAAGVLKKAASEELVEKNSSSKETNSEKGLQRNHLQHLGPSNHGMSPSSFD
MPNPTSEKPVWKLPHPILPFPGSPEALKRVTLSLNNEPSISLTKPRAKSLSAVDMDRCSK
PCKEPPKKTTFKKLINVKLSIGFIKSDFHKFKSKNCQHGDVSTGHSLGREPKGLENNWQG
LATGEEKKSKPIKAYSEENCSLESQKVKSWSQSSATNGQRAESLDDQMLSRHASCQASST
SDCGPEYENVRHYEEIPEYENLPFVMARGNPPELGWQNSSSVEDTDVSLYEVEEPYDAPD
GQLQLDPRHQPCSSGRCQDRQDELHLDLPSDEEVINSSDEDDVSSESSKGEPDPLEDKQD
EDAGMKSKVHHIAKEIMSSEKVFVDVLKLLHIDXXGAXXHASRQLXXPVIEDRILNQILY
YLPQLYELNRDLLKXXEERMLSWAEQQRIADIFVKKGPYLKMYSMYIKEFDKNIALLDEQ
CKKNSGFATVVREFEMSPRCANLALKHYLLKPVQRIPQYRLLLTDYLKNLLEDSVDHRDT
QDALAVVIEVANHANDTMKQGDNFQKLMQIQYSLSGHHEIVQPGRVFLKEGILMKLSRKV
MQPRMIFLFNDALLYTTPMQSGMYKLNNMLSLAGMKVRKPTQEAYQNELKIESVERSFIL
SASSASERDDWLEAISRAIEEYAKKRITFCPSRSLDEDSERKEEVSPLGAKAPIWIPDTR
ATMCMICTSEFTLTWRRHHCRACGKIVCQACSSNKCGLDYLKGQPARVCELCFQELQKLD
HQLSPRIGSPGNHKSPSSALSSVLHSIPSGRKQKKIPAALKEVSANTEDSTMSGYLYRSK
GSKKPWKHLWFVIKNKVLYTYAASEDVAALESQPLLGFTVAQVKDEHSDPRVFQLLHKGL
LFYVFKADDAHSTQRWIDAFQEGTVL
Download sequence
Identical sequences ENSRNOP00000055846 10116.ENSRNOP00000009118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]