SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000013805 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000013805
Domain Number 1 Region: 21-500
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.7e-107
Family L-arabinose binding protein-like 0.0000136
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000013805
Domain Number - Region: 523-571
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0141
Family TNF receptor-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000013805
Sequence length 890
Comment (Rattus norvegicus)
Sequence
VTCRLLRKFNLTGYVDSENHSMVIGGLFPVHYRTIPKIDPVFLILIELQAQSRLFLSRFN
FRGFRWMKTMIHTIKEINERKDILPNHTLGYQIFDTCFSISKTVESTFVFLTGQEEYKPN
FRNSSGKYLAGIIGSGGSSLSVASSRILEVYYMRFQVGYTSSSSILSDHFRFPTFYRTIP
SDKIQTEAMVNLIKHFGWVWVGAIAADDDYGKYGIKSFKEKLERSNLCVAFSETIPKVYS
NEKMQKAINAVKSSTAKVVVLYATDIDLRPFVLEVVHHNITDRTWIASEAWITSALIAKP
EYFPYFGGTIGFAIPRSVIPGLKEFLYDVHPSKDPNDVLTIEFWQTAFNCTWPNSSVPYN
VDYRGNMTGKEDRFYAMSDRLCTGEEKLEDLKNTYLDTSQLRITNNVKQAVYLLAHALDR
LSRSVVFDRKEYINNPKFLIFLVYSLMIYIMRMEFTTHDGRKIELDRSGDVKNGYYDILN
WQMDDAGEIAFVKFGEYKFTSSKYELVLSKNSTLFWNTESSELPDSFCTKLCPPGTRKGI
RQGKPTCCFDCIPCADGYVSEKPGQRECDPCSEDDWSNAEKSKCVPKLVEFLSYEEALGF
TLVILSIFGALVVMAVTVVYVIHRHTPLVKANDRELSFFIQMSLVITVLSSMLFIGKPCN
WSCMARQVTLALGFCLCLSSILGKTISLFFAYRISKSKTRLISMHPIFRKLIVLICVVGE
IGVCTAYLVLEPPRMFKNIEPQNVKIIFECNEGSIEFLYSIFGFNVLLALLCFLTTFVAR
QLPDNYYEGKCITFGMLVFFIVWISFVPAYLSTKGKFKVAVEIFAILASSYGLLGCVFLP
KCFIILLRPKRNTDETVGGRVPTLDKSIQLTSASVSSELNNTAESIVLDE
Download sequence
Identical sequences ENSRNOP00000013805 10116.ENSRNOP00000013805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]