SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000016757 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000016757
Domain Number 1 Region: 266-360,387-513
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-54
Family Voltage-gated potassium channels 0.001
Further Details:      
 
Domain Number 2 Region: 106-217
Classification Level Classification E-value
Superfamily POZ domain 7.59e-26
Family Tetramerization domain of potassium channels 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000016757
Sequence length 561
Comment (Rattus norvegicus)
Sequence
MLKQSTERRWSLSYKLWNTSETEDVPNTGSNQHRKSICSMGARTGSQASIAPQWTEGNYN
YYIEEDEDCGEEEDWKDDLAEENQKPEGPPAPLDGHTDTPTQLSTLKVNVGGHSYQLECC
ELANYPKTRLGRLVTSTSRNCQLGLCDDYEAKTDEYFFDRDPAVFQLIYNFYTSGVLLVR
DELCPRSFLEELGYWGVRLKYTPRCCRICFEERRDELSEQLKIQRELRAQAQAEEAEELF
RDMRFYGPQRQRLWNLMEKPFSSVAAKAMGVASNLFVLISVVALALNTVEEMQHQAEQGT
GGGDPRPILEHVEMLCVAFFTLEFLLRLASTPNLRRFARSALNLVDLVAILPFYLQLLLE
CFTSEDQRHGKGSPREHDLETVGRVGKVGQVLRIMRLMRIFRILKLARHSTGLRAFGFTL
RQCYQQVGCLMLFITMGIFSFSAAVYSVEHDVPGTNFTSILHAWWWAAVSISTVGYGDMY
PETHLGRLFAFLCIAFGIILNGMPISILYNKFSDYYSKLKAYEYTAIRRERGKVNFMQRA
TKKMAECLSGSNAQSATRQEN
Download sequence
Identical sequences D3ZZR6
ENSRNOP00000016757 10116.ENSRNOP00000016757 ENSRNOP00000016757 NP_001099840.1.100692 NP_001099840.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]