SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000021979 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000021979
Domain Number 1 Region: 110-224
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.19e-42
Family Frizzled cysteine-rich domain 0.00000927
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000021979
Sequence length 642
Comment (Rattus norvegicus)
Sequence
MAEEAVPSESRAAGRPSLELCAVALPGRREEVGHQDTAGHRRPRADSRCWARGLLLLLWL
LEAPLLLGVRAQAAGQVSGPGQQAPPPPQPQQGGQQYNGERGISIPDHGYCQPISIPLCT
DIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALP
PCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPE
FWTSNPQHGGGGYRGGYPGGAGPVERGKFSCPRALRVPSYLNYHFLGEKDCGAPCEPTKV
YGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAV
AVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSL
TWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVD
ALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYT
VPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQGGGGVPPHPPMSPDFTVFMI
KYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
Download sequence
Identical sequences G3V833
10116.ENSRNOP00000021979 ENSRNOP00000021979 ENSRNOP00000021979 NP_067089.2.100692 NP_067089.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]