SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000023709 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000023709
Domain Number 1 Region: 62-172
Classification Level Classification E-value
Superfamily GINS helical bundle-like 1.46e-37
Family PSF2 C-terminal domain-like 0.00000122
Further Details:      
 
Domain Number 2 Region: 1-60
Classification Level Classification E-value
Superfamily PriA/YqbF domain 1.11e-21
Family PSF2 N-terminal domain-like 0.0000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000023709
Sequence length 185
Comment (Rattus norvegicus)
Sequence
MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVDVPLWLAINLKQRQKCRL
LPPEWMDVEKLEQMRDEERKEETFTPVPSPHYMEITKLLLNHASDNIPKADTIRTLIKDL
WDTRMAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGAFLTQALNHMYKLRTNLQPSESS
QSQDF
Download sequence
Identical sequences D3ZSY6
ENSRNOP00000023709 10116.ENSRNOP00000023709 NP_001099660.1.100692 NP_001099660.1.4139 ENSRNOP00000023709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]