SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000025394 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000025394
Domain Number 1 Region: 2209-2302
Classification Level Classification E-value
Superfamily C-type lectin-like 3.12e-33
Family Link domain 0.0000947
Further Details:      
 
Domain Number 2 Region: 509-648
Classification Level Classification E-value
Superfamily FAS1 domain 3.66e-30
Family FAS1 domain 0.0017
Further Details:      
 
Domain Number 3 Region: 1714-1870
Classification Level Classification E-value
Superfamily FAS1 domain 6.93e-27
Family FAS1 domain 0.0054
Further Details:      
 
Domain Number 4 Region: 1474-1522,1600-1714
Classification Level Classification E-value
Superfamily FAS1 domain 1.24e-26
Family FAS1 domain 0.0025
Further Details:      
 
Domain Number 5 Region: 966-1123
Classification Level Classification E-value
Superfamily FAS1 domain 2.09e-23
Family FAS1 domain 0.006
Further Details:      
 
Domain Number 6 Region: 386-503
Classification Level Classification E-value
Superfamily FAS1 domain 2.49e-19
Family FAS1 domain 0.0074
Further Details:      
 
Domain Number 7 Region: 2300-2462
Classification Level Classification E-value
Superfamily FAS1 domain 7.46e-18
Family FAS1 domain 0.0088
Further Details:      
 
Domain Number 8 Region: 1132-1255
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000549
Family FAS1 domain 0.0097
Further Details:      
 
Domain Number 9 Region: 1546-1583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000795
Family Merozoite surface protein 1 (MSP-1) 0.047
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000025394
Domain Number - Region: 231-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000114
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 907-962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000352
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 2010-2137
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00154
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 1372-1499
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00377
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number - Region: 2141-2176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00377
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 199-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00502
Family Merozoite surface protein 1 (MSP-1) 0.03
Further Details:      
 
Domain Number - Region: 874-905
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0209
Family EGF-type module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000025394
Sequence length 2572
Comment (Rattus norvegicus)
Sequence
MAEPRILLLLCILVLCLAGSGFIRGQTVRSKRCDIHTKFITHTPCTACAAIRRRLCPSGW
SRNFPEKILLDCRYELQLRGSVVSLSGCSQECWKDVVQKACCPGYWGSQCYECPGGPATP
CSGHGTCLDGIGGNGTCVCQENFSGSACQDCRDPNRFGPDCQSVCNCVHGVCSRGPQGNG
SCQCFAGYTGPHCDQELPVCQSLRCPQNSQCSAEAPACKCLPGYIQQDNACLPLDPCQPS
PCSSLARCSVTPSGQPQCHCPENYHGDGKVCLPQDPCLTNFGGCPSNSTFCLYRAPGKAT
CMCWPGMTSINNDASEGCHVSCKPHSCDKSATCQVTPDRKTSCVCKSDEVGDGYACYGHL
LHEVQRANQIGLVLLRLRVAIAMLEQGCQEILTTSGPFTVLVPSMFSVSAISSSNMNATL
AQQLCRQHIIPGEHILENIGPSNTRRWWTLAGQEITVTFKNLRYSYKYEDQPQQFSIQKA
NYIAANGVFHTVTALRWQLPPPLPGDPKKTVGQILASTEAFTRFETILENCGLPAMLDGP
GPFTVFAPSNEAVDSLRDGRLIYLFTAGLSKLQELVRYHIYNHGQLTVEKLISKGRFLTM
ANQVLTVNISEEGRILLGPEGVPVRRVDVPAANGVIHMLEGILLPPTILPILPKHCDEEQ
HQTVLGSCVDCQALNTSICPPNSVKMDIFPKECVYTHDPAGLNVLKKGCAEYCNQTITKR
GCCKGFFGPDCTQCPGGFSNPCYGKGNCSDGVQGNGACLCFPDYKGIACHICSNPNKHGE
QCQEDCGCVHGLCDNRPGSGGVCQQGTCAPGFQGRFCNESMGNCGSLGLAQPCHPDAHCV
IQEGVARCVCHDGFEGNGFSCKRSSPCSHPDRGGCSENAECVPGDLGTHQCICHKGWSGD
GRICVAIDECGLDTRGGCHADALCSYVGPGQSRCTCKLGFAGDGYECSPIDPCRVGNGGC
HGLATCKAVGGGQRVCTCPPHFGGDGFSCYGDIIQELEANAHFSAFSQWFKNSSITLPAD
GKLTALVPSESAIRRLRPEDQAFWLQPKTLPELVRAHFLQGAFSEEELARLSGQQVATLS
ATTHWQIHNTSGRVQVQNATVDVPDLLATNGVLHIISQVLLPPRGDMQTGPGLLQQLDSV
PAFRLFGEQLKHHKLVAQIEAAKAYTIFVPTNHSLETQGNKSILGIDIVRHHVILGEALS
VEVLRKGGHRNSLLGPAHWLVFYNHSGQPEVNHVPLEGPLLEAPGSALFGLSGILAVGSS
RCLHSHAEALREKCVNCTRKFRCTQGFQLQDTPRKSCVYRSGLSFSRGCSYTCAKKIQVP
DCCPGFFGTLCEPCPGGLGGVCSGHGQCQDRFLGNGECRCQEGFHGTACEMCELGRYGPT
CSGVCDCDHGLCQEGLRGNGSCICNVGWQGLRCDQKITDRQCPKKCDPNANCIQDSAGIP
VCVCAAGYSGNGSYCSEVDPCTSGHGGCSPYANCTKVAPGQRTCTCLDGYTGDGELCQEI
NSCLVHNGGCHVNAECIPTGPQQVSCNCREGYSGDGIQSCKLLDPCSQNNGGCSPYAVCK
STGDGQRTCSCDSTHTVGDGITCHGRVGLELLRNKYASFFSLHLLEYKELKGDGPFTIFV
PHSDLISNMSQGELARMRAHRQLVFRYHVLGCRKLGSQELLDQGYVTALSGHTLRISERE
GSIYLNDFARVVSSDHEAVNGVLHFIDRVLLPPDVLHWEADTIPIPRRNVTAAAESFQYK
IFSRLLTVAGLLPMLQDASHRPFTMLWPTDSALEALSPDRKNWLYHEDHRDKLAAILRGH
VIRNIEASASDLPNLGQLRTMHGNTISFSCGLARPGELMVGENEARIVQRYLLFEGGLAY
GIDQLLEPPDLGARCDRFEPQPLQTKTCSICGLEPPCPRGSREQGSPEACWRHYSKFWAT
PLHSITMRGGSWITPSFWNRNHMGRGCHRKCVTTVWKPSCCPGHYGADCHACPGGPRSPC
SGHGVCLDGISGSGQCNCHPGFAGTACELCAPGAFGPQCQACRCAPHGRCDEGLGGSGSC
FCDEGWTGPRCDVQLELQPVCTPPCAPQAVCRVGNSCECSLGYEGDGRVCTVADLCQKGH
GGCSKHANCSQVGTVVTCTCLPAYEGDGWSCRARNPCLDGHRGGCSEHADCFNTGPNTRR
CECHTGYVGDGLQCLEELEPPVDRCLAESSPCHTDALCTDLHFQEKQAGVFHIQATSGPY
GLTFSEAKEACEDQGADLASLPQLSAAQQLGFHVCFLGWLANGSAAHPVVTPAADCGNNR
VGVISLGVRKNLSERWDAYCYRVRDVACQCRVGFVGDGISTCNGKLLDVLAATADFSTFY
GMLLGYANATQRGLDFMDFLEDELIYKTLFVPVNEGFLDNMTLSGPDLELHASNATFLSA
NASQGTLLPAHSGLSLFISDTGPDNISLVPLAPGAVVVSHVMVWDIMAFNGVIHALASPL
LTPPQPRAVLGSEPQPVALSLGVVITCGTLLGLVAGALYLRARRKAPGFSFSVFQAEDNA
DDDFSPWQEGTSPTLVSVPNPVFGSSDIFCEPFDDSVLEEDFPDTQRVLKVK
Download sequence
Identical sequences ENSRNOP00000025394 ENSRNOP00000025394 10116.ENSRNOP00000025394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]