SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000026706 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000026706
Domain Number 1 Region: 106-290
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 9.55e-51
Family Isochorismatase-like hydrolases 0.0000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000026706
Sequence length 297
Comment (Rattus norvegicus)
Sequence
MAAAEPSVAALAGGGVGAGAPSGGVPVLFCFSVFARPASVPHGAGYDVLIQKFLSLYGDQ
LDMHRKFVVQLFAEEWGQYVDLPKGFAVSERCKLRLVPLQIQLTTLGNLTPPSTVFFCCD
MQERFRPAIKYFGDIISVGQRLLQGARILGIPVIITEQYPKGLGSTVQEIDLTGVKLVLP
KTKFSMVLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALELVGRGIEVHIVADATSSRS
MMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
Download sequence
Identical sequences F2Z3T7 Q91V64
ENSRNOP00000026706 10090.ENSMUSP00000025503 10116.ENSRNOP00000026706 ENSMUSP00000025503 ENSMUSP00000025503 NP_079754.2.92730 XP_008772040.1.100692 ENSRNOP00000026706 ENSMUSP00000025503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]