SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000035757 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000035757
Domain Number 1 Region: 31-513
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.89e-95
Family L-arabinose binding protein-like 0.0005
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000035757
Domain Number - Region: 522-567
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0221
Family TNF receptor-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000035757
Sequence length 856
Comment (Rattus norvegicus)
Sequence
MKLLIVFSLLIVLIVFQVQISYVSLNNPASPGYYQDGDFVIGGLFSLRMTTGDTRSKLFD
FKDAIYLPEYVYGYLTKHYQHMLAMIFAIEKINKDPNILFNMSLGFYLFNVDFIEKKAIE
SSMALLSGESPPVPNYSCRPEKTDKLVAVIGGISTGISTQISRVLSLYNIPQISYAPFDH
SLGTRVQLQSPYQFPMHTTALYHGIIQLLLYFTWVWVGMVVTDDMRGELFLRDITEEMNN
HGLCVAFVEKIPEFSAQDRVTKKAFMERYTSTRVIVGFGDTYSLLRFVSSIIFHTNFGNV
WITTSYWDFTILPFYQFISRALFSVGRLSFSVRMDQILGFKDFLRSVQPRKYPHDIFLQD
VWSILFKCPYSYQHGVRILTQCEQNGTLSTRPLHVWDMNTLPPSYKVHAAVYAIAQALHE
ELSLGMEGDSFTKCVPQTHLPWKLHPFLQKGKLWRRTNQENIINKEVLATVFDIFNSQSL
QKGNEVQVQVGEFVFESHSVQHFSLNEKLITWPRNQKEIPLSLCSQSCPLGFRKTPVEGK
PSCCFDCLPCPDGEIANETDMDQCIKCPEDQYPNKQRNQCLPKITAFLSCEDPLGAVLVS
VAISLSAFSAMILGLFIHYRDTPIVRANNRNLSYLLLVSLMLCFFCSLIFICQPTTVTCI
LRQMIFGVVFSITISAILAKTFIVVVAFKVIKPGSTLQTWMVTRVSNAIVCCGSSIQVCI
CAVWLGTYPPFPDVDMQSEFGQIILWCNEGSTLAFYCVLGYLGFLASLSLLIAFLARRLP
DTFNEAKTITFSMLVFCSVWISFVPTYLSSKGKTMVAVEILSILASSSTLLGCIFLPKCY
VILMRSGGHSRKKIFK
Download sequence
Identical sequences D3ZSU0
ENSRNOP00000035757 10116.ENSRNOP00000035757 ENSRNOP00000035757 NP_001092984.1.100692 NP_001092984.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]