SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000040013 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000040013
Domain Number 1 Region: 772-992
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-36
Family DBL homology domain (DH-domain) 0.0018
Further Details:      
 
Domain Number 2 Region: 1153-1354
Classification Level Classification E-value
Superfamily PH domain-like 1.54e-31
Family Pleckstrin-homology domain (PH domain) 0.00011
Further Details:      
 
Domain Number 3 Region: 983-1100
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-24
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000040013
Sequence length 1356
Comment (Rattus norvegicus)
Sequence
VDHALEDEEDCDHDLETDGTPTAPGEGAPSRDGEKGEEDCGQDPGVEEHPMSEEEGEEEE
AKECVHNRDDRAPWDGGEPFLNEVVLTHVCSQSPEVPCWEPGLPETPGEVDEDSEDICNN
TELGKPNQDTGQDTEDASMGSPESEVSPDVQEQEAATDSPEVFEEDSVDAAEGEDQIARD
EPPNCEEDTNNRETAAATMQAGEDHGEDGDRVQEDPAEENCQIIPFESDSVEEDCSPTLT
ENPYELFPTESTSFCNNSGSLAESDKGQESVCKICVEEVPGIGPSLSQGDSLQDGSGEEA
PVPEVVVVPENEDPMDDALSSPYVMGVGLLSLGEGAQSDTQAASGTLSGYSTWEEGDSDG
GQVPVDRKNIATRARPHSGKVAGHVPETVLEETGPEACSSAMGIRDTGDEVRKIGILPEG
KPSESLRALPAKPRAFTLYPRSFSVEGRESPLSMFREPEGAGLDMHRVRRKEDNLSLPGA
IGSSGSFSQRSHLPSSGTSTPSSVVDIPPPFDLACITKRPITKSSPSLLIDGDTLEKASK
KKKSSFKRFLELTFRKKTESKVHVDMSLSSSRSSSESSYHGPARVLELDRRSLSNSPQLK
CHTGKLRASDSPASLIFYRDSKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFP
NADTSDYENIPAMNSDYENIQIPPRRPARTGTFTKLFEEQSRALSTANENDGYVDMSSFN
AFESKQQSSEQEAESAYTEPYKVCPISTTPKEDLTSDEEQGSSEEEDNASRDPSLSHKGE
GQSRAFVIAQELLSSEKAYVQMLQHLSLDFHGAVLRALENVEQEGREPLAQEELRQGLRE
LPAICDLHQGILESLEQRLGDCGEGQQQVADIFLAREQEFEHHAAHILQFDRYLGLLAES
CLLSPRLATTVREFEQSSQGGGQSMKHRMLRVVQRLFQYQVLLTDYLNNLCPDSAEYDNT
QSALNLISKVTDRANESMEQGENLQKLVHIEYSVRGQGDLLQPGREFLKEGTLMRVRGKS
RHPRHLFLMNDTLLYTHPQKDGKYRLKSSLPVANMKVSRPVMDKVPYALKIETPESCLTL
SASSCAERDEWHYCLSRALPEDYKTQALAAFHHSVEIRERLGISLGERLPTLVPVTHAMM
CMNCGCDFSLTVRRHHCHACGKIVCRNCSRNKYPLKCLKNRMAKVCDGCFRELKLRNGPV
PGPIRERPVSMSFPLSSSRFSSGSTFSSVFQSISPSTFKKQKKVPSALAEVAASGEGSAI
SGYLSRCKSGKRRWKKLWLVIKGKVLYTYLASEDKVAMESIPLLGFTIAPEKEEGSSEVG
PVFHLYHKKTLFYSFKAEDSSSAQRWMEAMEDASVL
Download sequence
Identical sequences 10116.ENSRNOP00000040013 ENSRNOP00000040013 ENSRNOP00000040013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]