SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000041059 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000041059
Domain Number 1 Region: 52-491
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.85e-104
Family L-arabinose binding protein-like 0.0047
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000041059
Domain Number - Region: 510-559
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00836
Family TNF receptor-like 0.013
Further Details:      
 
Domain Number - Region: 607-815
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0235
Family Calcium ATPase, transmembrane domain M 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000041059
Sequence length 852
Comment (Rattus norvegicus)
Sequence
LCDFTIAYLILKFSLILFRLTEPSCFWRIKSSEETDGDLRSDCGFVLLAFEEPTEENFYN
QLINFRISARKYEFFLVMFFATDELNKNPDLLPNMSLIFSLGDRMCEDTLGVLDQIHSQQ
NHSWHFINYICGLGRRCDIGLTGPSWTTSLKLAVHSMTPKLTILMVFFGPLNSNLRDHEQ
FPYVHQIAIKDTCLPHGMVSLMLQFGWTWVGLIILDNDQGIQFLSDLREEMQRHGICLAF
VNVIPETMEIYRTRAKIYDKQLMTSSAKVVIIYGEMNSTLEVSFRRWAYLGAQRIWVTNS
QWDVIINKTDFSLDFFHGTVTFAHHHSGMIIFRNVMQTISTSNYPVDISHSMLGWNHFNC
SISKNRHSKMDHFTFNNILEWLALHKFDVVLSEEGYNLYNAVYAVTHTYHELILQQVESQ
KVSESKGLFTDCQQVSSLLKTRVFTNPVGELVNMNHRENQCAEYDIFIIWNFPQGLGLKV
KIASYFPCFPHNQQLRTSEDLENTSTNKKKMASSVCSADCHPGFRRIWREEMAACCFVCS
PCPENEISNETNMDQCVNCPEYQYANTEKNKCIQKGVIFLSYEDPLGMALALIAFCFSAF
TAVVLWVFVKYHDTPIVKANNRILSYLLIVSLMFCFLCSFFFIGYPNRATCILQQITFGI
VFTVAISTVLAKTITVVLAFKVTDPGRRLRNFLVSGTPNYIIPICSLLQCFLCVIWLAIA
PPFVDIDEHSEHGHIIIVCNKGSVTAFYCVLGYLACLALGSFTIAFLAKNLPDTFNEAKL
LTFSMLVFCAVWVTFLPVYHSTKGKVMVAVEIFSILASSAGMLGCIFAPKVYIILMRPDR
NSIHKIREKSYF
Download sequence
Identical sequences ENSRNOP00000041059 10116.ENSRNOP00000041059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]