SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000043418 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000043418
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 1.03e-53
Family Globins 0.000000737
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000043418
Sequence length 147
Comment (Rattus norvegicus)
Sequence
MVHFTAEEKAAIISIWEKVDLEKIGGETLGRLLIVYPWTQRFFDKFGNLSSALAIMGNPR
IRAHGKKVLTSLGSAVENMDNLKETFAHLSELHCDKLHVDPQNFKLLGNMLVIVLSTHFA
KEFTPEVQAAWQKLVMGVANALSHKYH
Download sequence
Identical sequences O88754
10116.ENSRNOP00000043418 ENSRNOP00000043418 ENSRNOP00000043418 NP_742090.1.100692 NP_742090.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]