SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000043743 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000043743
Domain Number 1 Region: 34-145
Classification Level Classification E-value
Superfamily Immunoglobulin 6.02e-22
Family V set domains (antibody variable domain-like) 0.0003
Further Details:      
 
Domain Number 2 Region: 378-462
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000633
Family SPRY domain 0.002
Further Details:      
 
Domain Number 3 Region: 159-235
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000164
Family C1 set domains (antibody constant domain-like) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000043743
Sequence length 482
Comment (Rattus norvegicus)
Sequence
MARAHHGDATLPSILVNFIFLQLLTSGYGKSDFRVLGPPDPLLATVGQDKELPCKLSPNI
SAEGMELRWYRDKPSSAVHVYKNGKDVYDEQMTEYKGRTTFNGNRVARGEAAVKIHNVTM
FDNGTYHCVFKEHTSYDQATLWLKVAGRGSSPRIRVTNTQDKGIQAECTSAGWYPEPKVE
WLDLKGRPVPAETHFSVSTSTGLLAVLSIATPQDRAVGGLTCSISNPLLPGKVTETYLLA
PLSRRLLSTEIGPALPLILTALGLVSAAIACAFGKCHTEEQKTSEEEEEPGAGDEDELFH
ADYVVSRWTARQKKQGFGGHMGTNQGPQRTKRSSHEFITLDEALSLKTSPPTTTHTEDQA
SNTQSLKTHASHMQSTEKPTCGVLAVGCFSAHWELFKYPSSLPPSLLGTWGAILDFEAGE
ISFRNSTKPLIYVFSGLSFSGPLQPFFCLWTHDPRPLTICSVVRETKEDTGVSGGPDLPG
DS
Download sequence
Identical sequences 10116.ENSRNOP00000043743 ENSRNOP00000029416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]