SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000045161 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000045161
Domain Number 1 Region: 154-367
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-53
Family DBL homology domain (DH-domain) 0.0000861
Further Details:      
 
Domain Number 2 Region: 384-500
Classification Level Classification E-value
Superfamily PH domain-like 1.43e-20
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000045161
Sequence length 595
Comment (Rattus norvegicus)
Sequence
MEPEPAAPKQPRPRRRSRRASVLSEDQAAGLPADTPGPAANERCSLRRGSSFTFLTPGPH
WDFTLKRKRREKDDDVVSLSSLDLKEPSNKRVRPLGRVTSLANLISPVRNGAVRRFGQTI
QSFTLRGDHRSPASTQKSFSRATVPTPTKRRSSALWSEMLDISMKESLTTREIKRQEAIY
ELSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDAYIPLHEDLLARIGEAT
KPDGTVEQIGHILVNWLPGLNAYRGYCSNQLAAKALLDQKKQDPRVQDFLQRCLESPFSR
KLDLWSFLDIPRSRLVKYPLLLKEILRHTPKDHLDVQLLEKAILIIQEVLSDINLKKGES
ECQYYIDKLEYLDEKQKDPRIEASKVLLCHGELKNKSGHKLYIFLFQDILVLTRPVTRNE
RHSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFGNSDKAKNIFRVRFQDPSPGQSHT
LQANDVFHKQQWFNCIRSAIAPFQRAASPLELQGLPDLHEECEENNPSAGNLRAQRRSCV
LPGVMQVDHESVLECGSSVQTSEDTRNAKAHRPQHGLRRARDKAQLGGKKKETLV
Download sequence
Identical sequences ENSRNOP00000023945 XP_006254268.1.100692 10116.ENSRNOP00000045161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]