SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000047460 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000047460
Domain Number 1 Region: 69-508
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.65e-114
Family L-arabinose binding protein-like 0.00058
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000047460
Domain Number - Region: 516-563
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0195
Family TNF receptor-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000047460
Sequence length 861
Comment (Rattus norvegicus)
Sequence
MLFSWIFISCFLQIPILAGSYRSSECLVRMNYRLNGKGNVVIVGFFPAFAAYPLNETTDW
RMTKFTRDIMIEFKLRNYQCILAMMFAIEEINSNPYLLSNVSLGFEVNNVPHGQRKTLGK
LFGSLSGYDCAMPNYRIASEKNTAAVLTGPSWAISEYIGTLLDLYKFPQLTFGPFDSLLS
EQRRFSSLYQVAPKDTSLTVGIVSLMLHFHWIWVGLFIIDDHKGAQTLSDLRSEMDKNGV
CTAFVEMIVVTRGSFFTKSWKNQVQILESSSNVIIIYGDSDSLLSLIVNIKQKLLTWKVW
VLISQWDVSKFDDYFMVDSLHGALIFSHHREEIPNFTDFMQKSNPSKYPEDTYLHVLWHI
FFNCSFVKKDCKIVHNCLPNASLGFLPGNIFDMAMSEESYNVYNAVYAVAHSLHEMILNQ
VQFQPHEKGKKMVFFPWQLHPFLRKIQLINQYGCSVVLDYKRKSYVEYDILNFWNFPKGL
GLNVKVGTFFPNAPKEQKLSISSNMIQWATGSTEVPRSVCSESCHPGFRKTYQEGRVVCC
FDCTPCPENEISNETDMDQCVKCPQTHYANIEKTHCLQKTVTFLTYDDPLGKTLCVISLS
FSSLTAAVLGVFLKNRDTPIVKANNLALSYTLLITLMLCFLCPLLFIGRPSTASCILQQN
IFGLLFTMALSTVLAKTITVVIAFKITAPETVRRWLLISRAPNLIIPLCTLLQIFLSGIW
LTTSPPFIDKDVHSEHGHIIIICNKGSAVAFHCSLGYLGALALGSYFMAFLSRNLPDTFN
EAKFLAFSMLVFCSVWITFLPIYHSTKGKTTVAMEVFSILASGTSLLGIIFAPKCHIILL
RSEKNSLQYIKDKTHARRKTP
Download sequence
Identical sequences M0RC83
ENSRNOP00000047460 NP_001092963.1.100692 NP_001092963.1.4139 10116.ENSRNOP00000047460 ENSRNOP00000067193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]