SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000055320 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000055320
Domain Number 1 Region: 287-333
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000816
Family UBA domain 0.00029
Further Details:      
 
Domain Number 2 Region: 50-105
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000283
Family ZZ domain 0.026
Further Details:      
 
Domain Number 3 Region: 1-30
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000085
Family PB1 domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000055320
Sequence length 339
Comment (Rattus norvegicus)
Sequence
RDEDGDLVAFSSDEELTMTMSYVKDDIFCIYIKEKKECWQDHHPPCAQNARSMVHPNVIC
EGCNGPVVGIRSKFSVCPDNNLCRVCEGKGLHREHSKLIFPNPFGHLSDSFSHSRWLRKL
KHGHFGWPGNWNPGPPQAGDGRPCPTAESGIEADINVEHGGRGSHLTPTSPESSSTSTED
KSATQPSSCSLEVSKPDRAGEEHAQALTEQMKKIALESVGQPEEQMESGNCSGGDDDWTH
LSSKEVDPPTGELQSLQMPELEGTSSRLSQEGPTGLKGATLNPYLPPETDLRLIESLSQM
LSMGFSDEGGWLSRFLQTKNYDIGAALNTTQYSKCSPPL
Download sequence
Identical sequences ENSRNOP00000055320 10116.ENSRNOP00000055320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]