SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000056021 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000056021
Domain Number 1 Region: 386-435
Classification Level Classification E-value
Superfamily UBA-like 1.68e-17
Family UBA domain 0.00012
Further Details:      
 
Domain Number 2 Region: 113-170
Classification Level Classification E-value
Superfamily RING/U-box 1.17e-16
Family ZZ domain 0.011
Further Details:      
 
Domain Number 3 Region: 42-95
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000168
Family PB1 domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000056021
Sequence length 439
Comment (Rattus norvegicus)
Sequence
MASLTVKAYLLGKEEAAREIRRFSFCFSPEPEAEAAAGPGPCERLLSRVAVLFPALRPGG
FQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRREHRPPCAQEARSMVH
PNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHREHSKLIFPNPFGHLSDSFSHSR
WLRKLKHGHFGWPGWEMGPPAHRCLSPLISLNGPPCPSKSTASAPSEDPNVNFLKNVGES
VAAALSPLGIEVDIDVEHGGKRSRLTPTSAESSSTGTEDKSGTQPSSCSSEVSKPDGAGE
GPAQSLTEQMKKIALESVGQPEELMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPES
EGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKN
YDIGAALDTIQYSKHPPPL
Download sequence
Identical sequences 10116.ENSRNOP00000056021 ENSRNOP00000051415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]