SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000058079 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000058079
Domain Number 1 Region: 209-306
Classification Level Classification E-value
Superfamily HMG-box 3.14e-19
Family HMG-box 0.00011
Further Details:      
 
Domain Number 2 Region: 93-172
Classification Level Classification E-value
Superfamily HMG-box 6.02e-19
Family HMG-box 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000058079
Sequence length 398
Comment (Rattus norvegicus)
Sequence
MASLDNKSLWSEIDILKLLECMKKNITSDDSRDFKASQADLDWNNIAFGRFSGEMCKQKW
MEISCKLRKFRTLTELVLEAKELWTRAHKNNTIKHNPDRPKRPLTAYLRFYREHRAKYCQ
MYPRYTNAQLTKVLAEEYRQLPAEAKERYVQDFKKEKRAFQEKMAQLKKKHPFSGHPKKS
VVPRSHQTKDSKKSQGDMKTVKPLLNTEIPKTFSLAMQFQGEPRKPPMTAYHKFHQDSWS
SPELRHLSFKERWVEISRLWHRVPEEMKEHYSRQAVELQKQYWMKLDLWLKGLSPAECAA
YKKARATWGKGKIKLMSGDRSPKFERTEDLQSASEKGLQAKPGEVEELLDWRTNSSETNI
GHHGDFQASMEDMTDDSEDESSSNASDSSSTVNLTSDI
Download sequence
Identical sequences ENSRNOP00000058079 10116.ENSRNOP00000058079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]