SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000000482 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000000482
Domain Number 1 Region: 495-722
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.46e-58
Family Eukaryotic proteases 0.00000000582
Further Details:      
 
Domain Number 2 Region: 115-208
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-36
Family Kringle modules 0.0000062
Further Details:      
 
Domain Number 3 Region: 210-291
Classification Level Classification E-value
Superfamily Kringle-like 1.04e-32
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 4 Region: 303-387
Classification Level Classification E-value
Superfamily Kringle-like 1.98e-31
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 5 Region: 381-481
Classification Level Classification E-value
Superfamily Kringle-like 7.01e-29
Family Kringle modules 0.00039
Further Details:      
 
Domain Number 6 Region: 36-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.02e-21
Family Hairpin loop containing domain 0.00000829
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000000482
Sequence length 730
Comment (Cavia porcellus)
Sequence
MWASKLLPALLFQHILLHLLLLPIAVPSAEGQKKRRNTLHEFKKSAKTTLIKEDPLLKSK
SKKMSSADQCASRCTRNKGLPFTCKAFVFDKARKRCLWLPFNSMSSGVKKEFGHEFDLYE
KKDYIRNCIIGKGGSYKGTVSVTKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRHEVCDIPQCSEVECVTCNGETYRGPMDHTESGKICQRWDQQTP
HRHKFLPERYPDKGFDDNYCRNPDGKLRPWCFTLDPDTPWEYCAIKMCVAHSLMNDTDVP
VETTECLQGQGEGYRGTVNTIWNGVLCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDG
AESPWCFTTDPNIRVGYCSQIPKCDVSGGQDCYRGNGKNYMGSLSKTRSGLTCSMWDKNM
EDLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISHCEGDTTPTINL
DHPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWILTARQCFPARN
KDLKDYEAWLGIHDVHGRGEEKRRQVRNVSQLVYGPEGSDLVLLKLARPAVLDDFVSTID
LPNYGCTIPEKTTCSVYGWGYTGLINADGLLRVAHLYIMGNERCAQHHQGKVTLSESEIC
AGAEKIRSGPCEGDYGGPLVCEQHKMQMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHK
IILTYKVPQS
Download sequence
Identical sequences ENSCPOP00000000482 10141.ENSCPOP00000000482 ENSCPOP00000000482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]