SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000000881 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000000881
Domain Number 1 Region: 35-124
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.16e-37
Family SCAN domain 0.0000606
Further Details:      
 
Domain Number 2 Region: 439-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 384-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 480-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.62e-19
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 345-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 226-258
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000798
Family KRAB domain (Kruppel-associated box) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000000881
Sequence length 544
Comment (Cavia porcellus)
Sequence
MLKERPGMAEDPQHQMSVPVVKLEKELLWGRGQEDSSPETFRLRFRQFRYQEAAGPQEAL
RELQELCRRWLRPELHTKEQILELLVLEQFLTILPREFYAWIREHSPESGKALVAMVEDL
TDNMLDTKAVPCHMQGEQQETAIGRGTWEPNVHLGPVDIKPEWGMPHEEGVQGLDQSTKE
QLSQNPGDGTQAFQEQALSILQAGPSLPAVGTRDQEMAAGFLASGSQGLTPFKDMALTFP
EEEWRHVTPAQIDCFGEYVEPQVCAVSPGVGNKEKEIKSQQEDLKGALAGLTSERFEETA
VQGPVLGQACEQEPRGSGSGLPVLPASQHSIPLPDDLKTQDSFWKPFQCPECGKGFSRSS
NLVRHQRTHEEEKSYGCVECGKGFTLREYLMKHQRTHLGKRPFVCNECWKTFSQRHHLEV
HQRSHTGEKPYKCGDCWKSFSRRQHLQVHRRTHTGEKPYTCECGKSFSRNANLAVHRRTH
TGEKPYGCQVCGKRFSKGERLVRHQRIHTGEKPYHCLACGRSFNQRSILNRHQKTQHRQE
PPVQ
Download sequence
Identical sequences A0A286Y055
10141.ENSCPOP00000000881 ENSCPOP00000000881 ENSCPOP00000000881 XP_003470061.1.53824 XP_013008036.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]