SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000000899 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000000899
Domain Number 1 Region: 177-445
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.94e-112
Family N-acetyl transferase, NAT 0.0000000000697
Further Details:      
 
Domain Number 2 Region: 49-175
Classification Level Classification E-value
Superfamily Chromo domain-like 3.16e-40
Family Chromo barrel domain 0.000000677
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000000899
Sequence length 458
Comment (Cavia porcellus)
Sequence
MAAQGAAAAVAAATSGIVGEGEPGPGENAAVEGTAPSPGRVSPPTPARGEPEVTVEIGET
YLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVD
KIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEI
YRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLS
YRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK
LVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
Download sequence
Identical sequences H0UV75
XP_003477940.1.53824 10141.ENSCPOP00000000899 ENSCPOP00000000899 ENSCPOP00000000899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]