SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000001464 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000001464
Domain Number 1 Region: 34-162
Classification Level Classification E-value
Superfamily Lysozyme-like 6.48e-53
Family C-type lysozyme 0.000000584
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000001464
Sequence length 163
Comment (Cavia porcellus)
Sequence
VLAYIGAQGSDFPVNMKALLLLGLLVLSVTVQGKVYERCELARTLKRLGMDGYHGVSLAN
WMCLIKWESDYNTKATNYNPGDESTDYGIFQINSRYWCNNGKTPDAVDACHISCSVLLED
NIAQAVACAKRVVRDPQGIRAWMGWRNHCENRDVSQYVSGCGV
Download sequence
Identical sequences ENSCPOP00000001464 10141.ENSCPOP00000001464 ENSCPOP00000001464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]