SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000001664 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000001664
Domain Number 1 Region: 23-339
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.05e-84
Family N-acetyl transferase, NAT 0.0000475
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000001664
Sequence length 420
Comment (Cavia porcellus)
Sequence
PLGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLF
GDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFC
TNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGENFTFQIYKADMTCRGFREYHERLQTF
LMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQM
LILTPFQGQGHGAQLLETVHRYYIASPSVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFL
STHFFLLCFNSAWTISYSQVEYRAVQQHARRVYEILRLLVTDMSDAEQYRNYRLDIKRRL
VSPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
Download sequence
Identical sequences ENSCPOP00000001664 ENSCPOP00000001664 10141.ENSCPOP00000001664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]