SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000001844 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000001844
Domain Number 1 Region: 8-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.5e-21
Family Ubiquitin-related 0.0000244
Further Details:      
 
Domain Number 2 Region: 640-650
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000732
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000001844
Sequence length 1114
Comment (Cavia porcellus)
Sequence
MEPSDSPSAAMEEPDTLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLI
YQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTQLPSGASSGTGSASTTHGGGPLPGTRGP
GASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLL
CRMECRGAPQAQPSQPPPQAPAMAPEPGALSSQTSEAVESQAAPREPMEAEEVEERAPAQ
GPELAPSGPAAAPETNAPNHPSPAEYVEVLQELQRLESRLQPFLQRYYEVLGAAATTDYN
NNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACAPPRHLHVVRPMSHYTTPMVL
QQAAIPIQINVGTTVTMTGNGTRPPPTPSSEAPPPGPGQASSLAPSSATVESSTEGAPPA
GPTPPPATSHPRVIRISHQSVEPVVMMHMNIQDSATQPGGVPSAPTGPLGPPGHGQSLGQ
QVPGFPTAPTRVVIARPTPPQARPSHPGGPAVSGALQGAGLGSNASLAQMVSGLVGQLLM
QPVLVAQGTPGMAPPPAPATASASAGTTNTATTAGPAPGGPAQPPPPQPSTADVQFSQLL
GNLLGPAGLASPTITLAMPGVPAFLQGMTDFLQATQTAPPPPPPPPPPPPAPEQQTAPPP
GSPSGGTGSPGGLGPESLPPEFFTSVVQGVLSSLLGSLGARAGSSESIAAFIQRLSGSSN
IFEPGADGALGFFGALLSLLCQNFSMVDVVMLLHGHFQPLQRLQPQLRSFFHQHYLGGQE
PTPGNIRMATHTLIAGLEEYVRESFSLVQVQPGVDIIRTNLEFLQEQFNSIAAHVLHCTD
SGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPSLVSWLTTMM
GLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLSEEPMEVQGAERTAPEPQRENASPAPGT
TAEEAMSRGPPPAPEGGSRDDQDAAPAETEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPL
SDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESY
RQQLRSDIQKRLQEDPNYSPQRFPNAHRAFAEDP
Download sequence
Identical sequences ENSCPOP00000001844 10141.ENSCPOP00000001844 ENSCPOP00000001844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]