SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000002057 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000002057
Domain Number 1 Region: 20-119
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 5.75e-28
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0023
Further Details:      
 
Domain Number 2 Region: 109-187
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.000000000000798
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000002057
Sequence length 301
Comment (Cavia porcellus)
Sequence
MSDLGSEELEEEGENSLGEYEGERNEAGERHGHGRARLPNGDVYEGQYEFGQRNGQGVYK
FKNGARYTGQYLKNKKHGQGTFIYPDGSRYEGEWADDQRHGYGVYYYVNNDTYTGEWFAH
QRHGQGTYLYAETGSKYVGTWVHGQQVGAAELIHLNHRYQGKFLNKHPVGPGKYVFDIGC
EQHGEYKLTDVVFGTKWSEQDTLANIIPKWKATQITDLALWTPTLPEKQPSSVGPGPDET
LGEEGVPEMEEEVQALSDGFEGELDLRPGEEDTDAWELSSEIDQASTVVEEEEARQAELQ
D
Download sequence
Identical sequences ENSCPOP00000002057 10141.ENSCPOP00000002057 ENSCPOP00000002057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]