SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000002157 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000002157
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.09e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000452
Further Details:      
 
Domain Number 2 Region: 259-458
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.57e-61
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000158
Further Details:      
 
Domain Number 3 Region: 597-760
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.01e-39
Family AlaX-like 0.034
Further Details:      
 
Domain Number 4 Region: 515-593
Classification Level Classification E-value
Superfamily Translation proteins 2.2e-16
Family AlaX-M N-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000002157
Sequence length 968
Comment (Cavia porcellus)
Sequence
MSSTLTASEIRERFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPS
HPLAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPVDRLYVTYFGGDEAAGLEPDLECKQIWQNLGLDDTKILPGNMKDNFWEMGD
TGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNRETDGTLKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDADGIDMAYRVLAD
HARTITVALADGGRPDNTGRGYVLRRILRRAVRYSHEKLNASRGFFATLVDVVVQSLGDA
FPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDCKTIPGDTAWLLYDTYGF
PVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSHGKGAGGEDLIMLDIYAIEELRAKGLEA
TDDSPKYDYHSDSGGSYVFESAVATVLALRREKMFVEEVSTGQECGVVLDKTCFYAEQGG
QIYDEGYLVKVDDSSEDKTEFTVKNTQVRGGYVLHIGTIYGSLKVGDQVRLFIDEPRRRP
IMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMI
EAAKPVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLTSV
EFCGGTHLQNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAESLSKSLSAMEST
VKAQTAPNKDVQREIADLGEALASAVIPQWQKDELRETLKSLKKVMDDLDRASKADVQKR
VLERTKQLIDSNPNQPLVILEMESGASAKALNEALKLFKTHSPETSAMLFTVDNEAGKIT
CLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDMSAQATGKNVGCLQEALQLATSFAQ
LRLGDVKN
Download sequence
Identical sequences H0UYE7
ENSCPOP00000002157 10141.ENSCPOP00000002157 XP_003472166.1.53824 XP_005004667.1.53824 XP_005004668.1.53824 XP_013010335.1.53824 ENSCPOP00000002157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]