SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000002975 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000002975
Domain Number 1 Region: 555-826
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-80
Family Protein kinases, catalytic subunit 0.0000203
Further Details:      
 
Domain Number 2 Region: 400-510
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-35
Family Pleckstrin-homology domain (PH domain) 0.000000849
Further Details:      
 
Domain Number 3 Region: 115-189
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.94e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.001
Further Details:      
 
Domain Number 4 Region: 257-315
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.43e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000002975
Sequence length 879
Comment (Cavia porcellus)
Sequence
MAAAPSHAAGLPCSPRPGSPLSAGGLELHSPPQALVPQAPAPGISFHIQIGLTREFVLLP
AASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSAGDIQEGDLV
EVVLSASATFEDFQIRPHALTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRCA
FSIPNNCSGARKRRLSSTSLASGHSVRLGSSESLPCTAEELVRTWQGQVGGRGLDAHPSS
LPPSFYTARPIELDKMLLSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKF
NCHKRCATRVPNDCLGEALINGDMPMEEASDFNDSDKTALLMDESDDSGVIPGSHSENAL
HASEEEEGEEGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYW
RLDCKCITLFQNNTTNRYYKEIPLSEILSVEPSQNFSLVPPGTNPHCFEIITANATYFVG
ETPGGAPGGPSGQGAEAARGWEMAIRQALMPVILQDAPSTPGHAPHRQASLSISVSNSQI
QENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEV
AILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQIL
VALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLA
PEVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDISDQIQNAAFMYPANPWSLISTG
AIDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELERKMSERYITHESDDARWEQ
FVAEHPLPGPGLPTHVELAGAHLPQDHEMQGLAERISVL
Download sequence
Identical sequences ENSCPOP00000002975 ENSCPOP00000002975 10141.ENSCPOP00000002975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]