SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000003002 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000003002
Domain Number 1 Region: 4-174,220-330
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.43e-51
Family Calponin-homology domain, CH-domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000003002
Sequence length 332
Comment (Cavia porcellus)
Sequence
LLCLSVSELQEEGMNAINLPLSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKV
LIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTV
LEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQK
REGILQSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLN
LEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLE
KPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE
Download sequence
Identical sequences ENSCPOP00000003002 ENSCPOP00000003002 10141.ENSCPOP00000003002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]