SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000003605 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000003605
Domain Number 1 Region: 73-206,242-344
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.59e-58
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000535
Further Details:      
 
Domain Number 2 Region: 353-450
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.03e-27
Family Anticodon-binding domain of PheRS 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000003605
Sequence length 451
Comment (Cavia porcellus)
Sequence
MVCSALRRVAHAHICLVRRASHVCRGHQHRAWGSRPAASDVAARGAPGSVLELLGKSYLQ
DDHTNLTQKVLSKVGRNLHNQRHHPLWLIKERVKEHFYKQYVGRFGTPLFSVYDNLSPVV
TTWQNFDSLLIPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRR
DQIDCQHYPVFHQLEGVRLFSKHELFAGVKDGESLQLFEHGSRSAHKQETHSMEAMKLVE
FDLKQTLSRLVAHLFGDGLEIRWVDCHFPFTHPSFELEISFRGQWLEVLGCGVMEQRLVD
SAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWSEDDRFLKQFRLSDINQKVKFQPLSKY
PALTNDISFWLPTENYAENDFYDLVRTVGGDLVEKVDLIDKFEHPKTHRTSHCYRITYRH
MERTLSQREVSHIHQDIQAAVVRQLGVEGRF
Download sequence
Identical sequences H0V256
XP_013006787.1.53824 XP_013006788.1.53824 XP_013006789.1.53824 ENSCPOP00000003605 ENSCPOP00000003605 10141.ENSCPOP00000003605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]