SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000004222 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000004222
Domain Number 1 Region: 195-427
Classification Level Classification E-value
Superfamily PH domain-like 9.1e-81
Family SSRP1-like 0.0000063
Further Details:      
 
Domain Number 2 Region: 536-593
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000733
Family HMG-box 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000004222
Sequence length 672
Comment (Cavia porcellus)
Sequence
MAEMLEFSDIYQEMKGSMKEGHLRLDHQGIIFRHSKTGKVDNIQACELMEGVWRRVSLGH
GLKLLLKHGHVYRYDGFQESEFQRLSHFFKTHYHLELKEKDLCVKGWNWGTVKFGEQLLS
FDIGSQSVFEIPLSNVSQCTTAKNEVTLEFHQSDDVEVSLVEMRFYVPPTQEEGVDLVQA
FAQNVLSKADVIQATADAICIFQELQCLTPRGRYDIRIYPTFLHLHGKTFDYKISFSMVL
HLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKEENITLTLNMNEEEVEKRFEG
QLTKTMVGSRYEVFSRVMKALVNHKITVPGNFQGHLGAKCIACSYKASSGLLYPLEQDFI
YVHKPPVHVHFHEIACVNFARGITTTRFFDLEIETKQGTQFTFSSIQKEEYGKLFDFISA
KKLNIKNQELKDGKNPKYRKYTDSDEELHDAYLERMKEEGKIREENPNDSSDDLGEEMDE
SFKPGEEEEEEVAEEFDSNASTTSSFSNEGDSDQDEKEQKQLQRAKTAKDHKDHKKTQEV
KKNKDPSPHKKPTFAYTLWLKANQEKIKADHPGISTTDLPKKADKMWKRMSKKKGKLGHG
GKDEVASCECEKATKECEGGPCKSSKRDKAKTKKDRIKMDKKSPPPRGSSSKSSSRQLSE
SLEGKDSVPRGE
Download sequence
Identical sequences ENSCPOP00000004222 ENSCPOP00000004222 10141.ENSCPOP00000004222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]