SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000005657 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000005657
Domain Number 1 Region: 90-162
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.85e-17
Family Complement control module/SCR domain 0.0002
Further Details:      
 
Domain Number 2 Region: 151-224
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.37e-17
Family Complement control module/SCR domain 0.00031
Further Details:      
 
Domain Number 3 Region: 211-274
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000445
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 406-467
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000162
Family Complement control module/SCR domain 0.00099
Further Details:      
 
Domain Number 5 Region: 30-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000249
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 6 Region: 365-415
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000229
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 293-349
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000157
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000005657
Sequence length 533
Comment (Cavia porcellus)
Sequence
MFPRLQAVSAPALLQITLMAVLLAPVLGDCGPPPILPFASPVIQSYETNFRTGTALKYNC
HRGYWRVNSSHVICDINGSWIYNVFCAKKRCRNPGELANGKVEIITDLLFGSTIEFSCSK
GYSLIGSTTSQCESQGKTVDWSDPLPECVIVKCDSPPDISNGKHSGTDEDLYTYGSLVTY
VCDPNYSLLGNASISCLVANKTVGVWSSNPPTCEKVICRQPHIPKGIFLSGFGFYYTYKD
TLVISCKKGYILRGSSIIHCEANSKWYPSIPTCEPNGCIDLPEVPYISWERNVLSLKNQE
IFEIGSLLKYDCKTGYRPTPNEPRTVTCQENLKWAISKGCERVCCPTPNMEKMRIINERR
DFTGVCVYAYEDYIFYMCDEGYYPISADGRSSCQADGMWNPKMPACESAVCLKPDILNGK
LSVEKDHYTETENVTIHCDSGYEVVGPQNIICSENRTWTPEIPKCEWEVPEECKQVAAGR
KLLECLPNPSDVKMALEVYKLSLEIEQLEKEKYVKIQEKFSKKEMKQLTSALH
Download sequence
Identical sequences O08569
10141.ENSCPOP00000005657 ENSCPOP00000005657 NP_001166498.1.53824 ENSCPOP00000005657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]