SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000006091 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000006091
Domain Number 1 Region: 2-82
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000905
Family Extracellular domain of cell surface receptors 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000006091
Sequence length 97
Comment (Cavia porcellus)
Sequence
VMALWCYACHEPTSVSSCITITEYNANETLCKTILYTLEILYPFLGDSTVTKSCSSKCET
LDINGIGQTTSISCCNADLCNMDRALALGGTHSLALA
Download sequence
Identical sequences 10141.ENSCPOP00000006091 ENSCPOP00000006091 ENSCPOP00000006091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]