SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000006722 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000006722
Domain Number 1 Region: 184-533
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-83
Family Protein kinases, catalytic subunit 0.000000371
Further Details:      
 
Domain Number 2 Region: 32-181
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.42e-45
Family Regulator of G-protein signaling, RGS 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000006722
Sequence length 590
Comment (Cavia porcellus)
Sequence
MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEDLQRTIDRDYCSLCDKQ
PIGRLLFRQFCETRPRLECYIQFLDSVAEYEVTPDEKLGEKGKEIMTKYLTPKSPVFIAQ
VSQDLVSQTEAKLLQRPCKELFSACAQSVHDYLRGEPFHEYLDSMYFDRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRIKKRKGESMALNEKQILEK
VNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEERALFYAAEILCGLE
DLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGDLIRGRVGTVGYMAPEVLNNQ
RYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKSIC
RMLLTKDAKQRLGCQQEGAAEVKRHPFFRNMNFKRLEAGMLDPPFIPDPRAVYCKDVLDI
EQFSTVKGVNLDHTDDDFYSKFSTGSVSIPWQNEMIETECFKELNVFGPDGTLSWDLNRS
QPPEPPKKGLLQRLFRRQHQNNSKSSPNSKTSHNHHINSNHVSSNSTGSS
Download sequence
Identical sequences H0VA55
10141.ENSCPOP00000006722 XP_003479681.2.53824 ENSCPOP00000006722 ENSCPOP00000006722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]