SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000007159 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000007159
Domain Number 1 Region: 432-645
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.09e-41
Family Biotin holoenzyme synthetase 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000007159
Sequence length 704
Comment (Cavia porcellus)
Sequence
MEDRLRMENGLVPQKIVSVYLQDSALQELADQASCGRAAALLPRADLSPETEPTLDGKDS
SEASGDGTSEPGLTEHLHLHLSSCHECLELESSTIESVKFASAEDIPELPYDASGGPQAA
SNGLSQERAGRRGNAVGKAPNILLYVGSSQDAPDQLQQVQALLADCVDTDRYLLYPLPED
SARRDPWLDHCVLLVIATRKPIPEDVHQKFTAYLAQGGKVLSLSSSFLLGDLRMTCKAAL
QSTVQNLVFSKAGGGDLRLSALSSGCVYKDSPEEILGPDRLQGHLENEDKDRVIVQVPFG
DCGGEAILCQVHLELPPSSSVVQTQEEFNLLKSSNVSRYEVLKEILDALGLSCGTQQAPA
LTPLHLLTVAEEIRGPFMQWLGRRVDPGGVIKSSKLALKFVSSYTPEVEITPSSVPVVTD
TEAFSSEHFNLEIYRQNLQTQRLGKIILFAEVTTTTMSLLDGLMFEMPQEMGLIAIAGRQ
TQGKGRGPNAWLSPLGCALSTVLLSIPLRSHLGQRIPFVQHLMSLAIVEAVRSIPEYQDI
NLRVKWPNDIYYGDLMKIGGVLVNSTLMGDTFYILIGFGFNVTNSNPTICINDLIEEYNR
QHGTELKPLRADYVIARAVTLLERLIDTFQDKGPDGVLPLYYKYWVHSGQQVRLGKAEGP
QVWIVGLDDSGYLQVHQDGGEVVTVHPDGNSFDMLRNLVLPKRW
Download sequence
Identical sequences ENSCPOP00000007159 ENSCPOP00000007159 10141.ENSCPOP00000007159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]