SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000007615 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000007615
Domain Number 1 Region: 182-490
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.1e-75
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000231
Further Details:      
 
Domain Number 2 Region: 58-179
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.000000000000288
Family Seryl-tRNA synthetase (SerRS) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000007615
Sequence length 524
Comment (Cavia porcellus)
Sequence
MAASVPRRLWPLLSRPGLRSRGDSVYNQNPWRNFATEKRSPNLLYQHAREGYSALPHLDM
ELLCACPEKVARALELRKGELRPADLPGIISTWQELRQLQEQIRSLEAEKDTVAEAVRAL
LVNQDHSQVQQDPQYQALRTRGREIRKQLVLLYPREDQLEEQFYLQALRLPNQTHPDVPV
GNESQARVLQVVGDKPAFSFQPRGHLEIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQH
GLVNFTLSKLVRRGFTPMTVPDLLRGAVFEGCGMTPNASPSQVYNIDPSRFEDLNLAGTA
EVGLAGYFMDHSVAFRDLPVRTVCSSTCYRPETDTGREPWGLYRVHHFTKVEMFGVTGPG
LEQSSQLLEEFLALQVEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVT
SASNCTDFQSRRLHIMFQTETGELCFAHTVNATACAVPRVLIALLESNQQRDGSVLVPPA
LQPYLGTDRITAPTHVPLQYIGPNQPQKPSLPPPAPICGLSLPP
Download sequence
Identical sequences ENSCPOP00000007615 10141.ENSCPOP00000007615 ENSCPOP00000007615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]