SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000007830 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10141.ENSCPOP00000007830
Domain Number - Region: 174-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.032
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000007830
Sequence length 532
Comment (Cavia porcellus)
Sequence
MKMRRYKLFLMFCMAGLCLISFLHFFKTLSYVTFPRELASLSPNLVSSFFWNNAPVTPQA
SPEPGGPDLLRTPLYSHSPLLQPLPPSKAAEELHRVDFVLPEDTSEYFVRTKAGGVCFKP
GTKMLEKPPSGRPEEKPEGSEGSSGARGSARRPPRHMLSARERAGSSRGARRKWVECVCL
PGWHGPSCGVPTVVQYSNLPTKERLVPREVPRRVINAININHEFDLLAVRFHELGDVVDA
FVVCESNFTAYGEPRPLKFREMLTNGTFEYIRHKVLYVFLDHFPRGGRQDGWIADDYLRT
FLTQDGVSRLRNLRPDDVFIINDADEIPARDGVLFLKLYDGWTEPFAFHMRKSLYGFFWK
QPGTLEVVSGCTVDMLQAVYGLDGIRLRRRQYYTMPNFRQYENRTGHILVQWSLGSPLHF
AGWHCSWCFTPEGIYFKLVSAQNGDFPRWGDYEDKRDLNYIRSLIRTGGWFDGTKQEYPP
ADPSEHMYAPKYLLKNYNQFRYLLDNPYQEPKSTAVGGRRSKGPEAGHPQPG
Download sequence
Identical sequences ENSCPOP00000007830 ENSCPOP00000007830 10141.ENSCPOP00000007830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]