SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000007947 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000007947
Domain Number 1 Region: 302-584
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.83e-91
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000114
Further Details:      
 
Domain Number 2 Region: 125-299
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.19e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00022
Further Details:      
 
Domain Number 3 Region: 586-694
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.28e-27
Family Anticodon-binding domain of Class II aaRS 0.0014
Further Details:      
 
Domain Number 4 Region: 63-122
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000085
Family TGS domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000007947
Sequence length 703
Comment (Cavia porcellus)
Sequence
QPSPIQSQEKDTKKQKLKENGFDGEVKQPDFIKERLKLFETLKKDHQHLLSIHEKKENAS
TVITVRMVDGKTVEGEVWETTPYQVAAEISQELAENTVIAKVNGELWDLDRPLEGDSALE
LLMFDNEEAQAVYWHSSAHILGEAMELYYGGHLCYGPPIENGFYYDMFMEDRAVSSTELA
ALENICKTIIKEKQPFERLELSKETLLDMFKYNKFKCRILKEKVNTPTTTVYRCGPLIDL
CKGPHVRHTGKIKSIKIFKNSSAYWESNPEMETLQRIYGISFPANKMMRSWQKFQEEAKN
RDHRKIGKEQELFFFHDLSPGSCFFLPRGAFIYNTLMDFIREEYHNRNFTEVLSPNVYNS
KLWETSGHWQHYNENMFTFDIEKDTFALKPMNCPGHCLMFAHRPRSWREMPVRFADFGVL
HRNELSGTLSGLTRVRRFQQDDAHIFCTVEQIGEEIKACLQFLQSVYSTFGFSFQLNLST
RPEDFLGEQPVWDEAEKQLQNSLVEFGKPWKINPGDGAFYGPKIDIKIKDAIGRYHQCAT
IQLDFQLPIRFNLTYVSKDGDDKKRPVIIHRAILGSLERMIAILSEHYGGKWPFWLSPRQ
VMVIPVGPTCEKYALQVSSEFFEEGFMADTDLDDSCTLNKKIRNAQLAQYNFILVVGEKE
KINNAVNVRTRDNKIHGEISVTSVIDKLKNLKKSRTLNAEEEF
Download sequence
Identical sequences ENSCPOP00000007947 10141.ENSCPOP00000007947 ENSCPOP00000007947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]