SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000008202 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10141.ENSCPOP00000008202
Domain Number - Region: 148-215
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000276
Family N-acetyl transferase, NAT 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000008202
Sequence length 285
Comment (Cavia porcellus)
Sequence
SPPAATAYPVDAVEDALEAQQEAARALAYYTSLGDRTGPSAETFCLPTGEQVKLETSSVC
MCTVHRDEPQHKILVLVNPRDTKTVVAVYLKKSWWSTEDVLRTADPTREGLMKVQSFGER
IVLFILNVIIFGRLERNLDDDDMFFLPHSVKEQAKILWKNGAAVGFYTTKLKGSLCGDGT
SACYLLPVFDTVFVRRIHRRQGLGTAMLRDFCETFQGEEALGFSRPISPAMFQVCRQFLL
ACPEERGRLWEVEPPGAWDQRVNIWLQVQLQQAGIPDGEWARKQC
Download sequence
Identical sequences ENSCPOP00000008202 10141.ENSCPOP00000008202 ENSCPOP00000008202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]