SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000008271 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000008271
Domain Number 1 Region: 618-860
Classification Level Classification E-value
Superfamily vWA-like 9.64e-75
Family Trunk domain of Sec23/24 0.00000689
Further Details:      
 
Domain Number 2 Region: 388-536,861-955
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.05e-72
Family beta-sandwich domain of Sec23/24 0.00045
Further Details:      
 
Domain Number 3 Region: 1062-1210
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 5.23e-33
Family C-terminal, gelsolin-like domain of Sec23/24 0.0022
Further Details:      
 
Domain Number 4 Region: 957-1061
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 2.35e-29
Family Helical domain of Sec23/24 0.001
Further Details:      
 
Domain Number 5 Region: 536-617
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 5.36e-23
Family Zn-finger domain of Sec23/24 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000008271
Sequence length 1211
Comment (Cavia porcellus)
Sequence
GPAQSQMQVPSGHGLHHQNYVAPSGPYSLEPGKLASSLPDGQCNDYYSGLYTLPAQKVAT
PGAASHTGAQQVYCGGPPAPPLLGTLPGPVPGATVAASHMHTSASQPYPSFVNYYSSPTI
YTASSSAASQGFPATCHYGVSAVSNAVHPSVSYSSLPPGDPYTQVFTSQSALATGPGRKG
SFPGQNAAPSRPSALAAPLPPQHLQQQSLAGYSALSWSVPGLPPTQDKLIRNHSGPLASA
SSSPANPVADSLAGPSMQNAPPPRSSPVVSTALPGALSTRVLPAGKHPGELVALGAQPQE
LPPQKGMQYGDYVNNQASSAPTPLSSASDDEEEEEDEEAGVDSSSTTSSASPVPNSYDVL
EGGGYPDMHSSSASSPAPDPVPEPQPVPTPTAPQSAKVAKPFGHSYPALQPGYQNAAAPP
TSGVQPGAVPYAAFQQYPQQYPGVNQLSSSLGGLSLQSSPQPESLRPVNLTQEKDVLPPT
PIWAPVPNLNLDLKKLNCSPDSFRCTLTNIPQTQALLNKAKLPLGLLLHPFRDLTQLPVI
TSNIIVRCRSCRTYINPFVSFIDQRRWKCNLCYRVNDVPEEFMYNPLTRSYGEPHKRPEV
QNSTVEFIASSDYMLRPPQAAVYLFVLDVSHNAVEAGYLTVLCQSLLENLDKLPGDSRTR
IGFMTFDSTIHFYNLQEGLSQPQMLIVSDIDDVFLPTPDGLLVNLYESKELIKVLLNALP
SMFTNTRETHSALGPALQAAFKLMSPTGGRVSVFQTQLPSLGAGLLQSREDPNQRSSTKV
VQHLGPATDFYKKLALDCSGQQTAMDLFLLSSQYSDLASLACMSKYSAGCIYYYPSFHCT
HNPSQAEKLQKDLKRYLTRKIGFEAVMRIRCTKGLSMHTFHGNFFVRSTDLLSLANINPD
AGFAVQLSIEESLTDTSLVCFQTALLYTSSKGERRIRVHTLCLPVVSSLAEVYAGVDVQA
AICLLANMAVDRSVSSSLSDARDALVNAVVDSLSAYGSAVSNFQHSGLIAPASLKLFPLY
VLALLKQKAFRTGTSTRLDDRVYAMCQIKSQPLVHLMKMIHPNLYRIDRLTDEGAIHVSD
RVVPQPPLQKLSAERLTREGAFLMDCGSVFYIWIGKSCDNNFIEDVLGYPNFASIPQKMT
YLPDLDTLSSERTRSFVAWLRDSRPLSPVLHVVKDESPAKAEFFQHLVEDRTEAAFSYYE
FLVHVQRHICK
Download sequence
Identical sequences ENSCPOP00000008271 10141.ENSCPOP00000008271 ENSCPOP00000008271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]