SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000008460 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000008460
Domain Number 1 Region: 116-221
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-19
Family I set domains 0.024
Further Details:      
 
Domain Number 2 Region: 233-327
Classification Level Classification E-value
Superfamily Immunoglobulin 2.09e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 1610-1697
Classification Level Classification E-value
Superfamily Immunoglobulin 9.42e-19
Family I set domains 0.042
Further Details:      
 
Domain Number 4 Region: 1340-1434
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-18
Family I set domains 0.039
Further Details:      
 
Domain Number 5 Region: 1806-1888
Classification Level Classification E-value
Superfamily Immunoglobulin 5.73e-17
Family I set domains 0.024
Further Details:      
 
Domain Number 6 Region: 786-880
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000182
Family I set domains 0.041
Further Details:      
 
Domain Number 7 Region: 1157-1252
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000265
Family I set domains 0.042
Further Details:      
 
Domain Number 8 Region: 968-1063
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000863
Family I set domains 0.052
Further Details:      
 
Domain Number 9 Region: 878-973
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000155
Family I set domains 0.039
Further Details:      
 
Domain Number 10 Region: 1059-1145
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000635
Family I set domains 0.037
Further Details:      
 
Domain Number 11 Region: 321-416
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000229
Family I set domains 0.018
Further Details:      
 
Domain Number 12 Region: 714-799
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000287
Family I set domains 0.013
Further Details:      
 
Domain Number 13 Region: 1440-1525
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000573
Family I set domains 0.0093
Further Details:      
 
Domain Number 14 Region: 1714-1801
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000305
Family I set domains 0.0068
Further Details:      
 
Domain Number 15 Region: 1249-1343
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000858
Family I set domains 0.02
Further Details:      
 
Domain Number 16 Region: 11-109
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000015
Family I set domains 0.019
Further Details:      
 
Domain Number 17 Region: 1532-1619
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000518
Family I set domains 0.0049
Further Details:      
 
Domain Number 18 Region: 503-592
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000107
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 19 Region: 417-493
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000624
Family I set domains 0.0091
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000008460
Domain Number - Region: 607-704
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00649
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000008460
Sequence length 1889
Comment (Cavia porcellus)
Sequence
MKAGSGDQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPTVVWEKGGQPLEASERLSF
PADGEHGLLIRRALQNERRKTNENKCKSGNGLGVIFFLLTYCVTVLEPPAGSKEGPPVFL
TGPRSQWVLRGTEVVLTCRVGGLPAPTLYWEKDGLALDEEWDRSHFALERGAANGPGSSL
GLRIPAARLPDSGVFVCHARNAHGHAQAGALLQVQQPPESPPEDSDEAPTPVAEPQKCAP
KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAK
DRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDAEGRENGIVVLECKVPNSRIPTA
WFREDQRLLPCRKYEQIEEGAIRRLIIHRLRADDDGVYLCEMRGRVRTVANVTVKGPILK
RLPRKLDVLEGENAVLLVETQEAGVKGHWSRNGEELPAICQSISGHMHALVLPGVTREDA
GEVTFSLGNSRTTTLLRVKCMKHNPPGPPMMAEMFKGHKNTILLTWKPPEPLPETSFIYR
LERQEVGSEDWIQCFSVEKAGTVEVPGDCVPSEGDYRFRICTVSEHGRSPHIVFQGSAHL
VPTARLVAGLEDVQVYDGEDAIFSLKLSTIIQGTWFLNGEELKGNEPEGQVELGALRYRK
EQKGLQHRLILQAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPEDKVSLTFTALE
RVVLTCELSRVDFPATWYKDGQKVEESQSLVVKVDGRKHRLILPEARVQDSGEFECRTEG
VSAFFSVRVQDPPVHIVDPQEHVFVHAITSECVVLTCVVDREDALVHWYKDGQEVEESDF
IVLENEGPHHRLVLPAAQPLDGGEFQCVAGEERACFTVTITDVSSWIVYPSGKVYVAAVL
LERVVLTCELCRPWAEVRWTKDGTEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEI
NDESASFTVTVTEPPVRIINPRDEVALIAVSLECVVLTCELSREDAPVRWYRDGLEVEES
EALVLESDGPCRRLILPAAQPQDGGEYVCDAGDDSAFFTVTVTAPPERIVHPAARTLDLQ
FGAPGRVELHCEVAPAGSQVRWFKDGLEVEVSDALQLGAEGPSRTLTLPHAQPEDAGEYV
CETRDEAVTFNVSLAAEPPVQFLAPEAAPSPLCVAPGEPVVLSCELSRATAAVSWSHNGS
PVQEGKGLKLQAEGPRRALCIQAAEPAHAGLYTCQCGMAPGAPSLSFTVQVAERPVRVVA
PEAAQTRVRSAPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGA
RSRDAGEYLCDAPQDSRIFLVTVEELPPVKLVSELTPLTVHEGDDATFRCEVSPPDADIT
WLRNGAIVTPGPQLEVAQNGSSRTLTVRGCRLEDAGTVTAQAGSTASSARLHVRETELLF
LRRLQDVRAEEGQDVCLEVETGREGTPGAVRWMRGGDPLPPDSRLCVAQEGHVHRLFIHG
VVLADQGTYGCESHHDRTLARLSVRPRQLRALRPLEDVTISEGGSATFQLELSQEGVTGE
WARGGVRLQPGPKCHIHAEGHTHRLVLSDLSRADSGCVSFTTDALRCAARLTVREVPVTI
VRGPQDLEVTEGDTATFECELSQALADVTWEKDGRTLTPSPRFRLQALGTRRLLQLRRCS
SSDAGTYSCAVETSRSGPVRLTVRGSAPERRVSVLQELRSVRAREGDGATFECTVSEAET
PGCWELGGRQLRPGGRIRIRQEGKKHILVLSLLRAEDAGEVRFQAGPAQSSALLEVEALP
LQMCRRPPREKTVLAGRRAVLEVTVSRSGGYVCWLREGVELCPGDKYEMRSHGPTHSLVI
HDVRPEDQGTYCCQAGRDSADTRLLVEGE
Download sequence
Identical sequences ENSCPOP00000008460 ENSCPOP00000008460 10141.ENSCPOP00000008460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]