SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000008828 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000008828
Domain Number 1 Region: 40-160
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000738
Family Growth factor receptor domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000008828
Sequence length 236
Comment (Cavia porcellus)
Sequence
VRSPTCCPASLLSHLAFFDQSQMHCVSKAVGTGAGSNCTGCIICSEENGCSTCQQKLFLL
IRREGIRQYGKCVHDCPLGFFGIRGQEINRCKKCGTTCDSCFSQDFCIRCKRRFFLHKGK
CLRTCPPGTLTQQNTRECQEECKLGPWGSWGPCMHGGKTCGTTWGLETRVRETGQAGREE
EATCQVQSESRKCPIQRPCPGERAARQKKGRKDRRQRKDRKLERRPDGRPRQPDLQ
Download sequence
Identical sequences 10141.ENSCPOP00000008828 ENSCPOP00000008828 ENSCPOP00000008828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]