SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000009071 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000009071
Domain Number 1 Region: 234-316
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000163
Family Canonical RBD 0.0053
Further Details:      
 
Domain Number 2 Region: 564-644
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000244
Family Canonical RBD 0.0044
Further Details:      
 
Domain Number 3 Region: 1470-1524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000265
Family HkH motif-containing C2H2 finger 0.044
Further Details:      
 
Domain Number 4 Region: 456-541
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000624
Family Canonical RBD 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000009071
Sequence length 1530
Comment (Cavia porcellus)
Sequence
QDWIQHQNTSTHIESCRQLRQQYPDWNPEILPSRRNESNRKENETPRRRSHSPSPRHSRR
SSSSHRFRRSRSPIRYPYRPRSRSPRICHRFISRFRSRSRSRSRSPYRIRNPFRGGSRCY
RSVSPERTSRRSVRSSVDRKKALEDVVQRSGHGAESNKQKHLEAVDKGHSPAQKPKIVSG
TKQSVKSTASTKSDANLGGHSIRKSKNLEDDGLSESKQMSDKAASIQHKLRKEQSLRYGS
VLLVSELPEDGCTEEDIRKVFQPFGKVTDVLIVPYRKEAYLEMELKAVTSVIKNVDTVPL
LIKGKSVKVSVPGKKKVQNKEMKKKTSDSKKSSTTALKKDTDTSKTVEIVTSTSTVDSSQ
SSVKITYVSKDLGKSAGSVKSVVTVAAKGKAMKTAKSTGKKSVEVKKVGNIKNKDSSKPI
TLPANSEIKTSIEVKVTENSIKEIISEAALEAKEIEPISEETEEMCVILISNLPNKGYST
EEICNLAKPFGGLKDILILSSHKKKALIEINRKSADSMVKFYTCFPISMDGNQLSISVAP
ENMNIKDEEVLFTTLIKETDPEKANTDKIYNRFVHFDNLPEDGLQCVLCVGLQFGKVDHH
VFISNKNKAILQLESPESAQSMYNFLKQNPQNIGDHILTCSLSSKIDSSEVQTEKEPELV
RESPGLKNNPVDESEVQTAADSPSLKPSKVEEETTPSIHTETLVQQEEPCEEEPEKVLCN
SDLGIETLEVETQGEINIELPLVASTSASIELFTENTEESALNQAYTSDLEKEEAEAVNP
ETELSTSGSALVEERSIKGIIPLEPPSEADDFFSEITQSMVEAVVEVDNHEHVSEIVPST
CVVTTVLGDTGDEKEISKKDISEKSNMDEKEENEFITKETRMDLQIGTEKTEKNDTKTIA
EKLEKIMTAVKEKSAESMIKAYPSKGVGQTNKPDETGKTSILAGSNVCSSKSGIKATMVP
SKAKATASKTENQRSFLKSVAKDQINAEKKLSTKEFGLLKSARSGLAEGSNKFKPTQSGG
TRGGSGKISALQGKDTKLDYKDITKQSQETEARLSIMKRDDSNNKALTGQNTKNSKSTTG
RSSKSKEEPLFSFNLDEFVTVDEVIEVVNPSQAKQNPLKGKRKEALRNNPPSELNLKKKK
GKTSASHSVEGELSFVTLDEIGEEEDADAQALVTVDEVIDEEELNMEEMVKNSNSLLTLD
ELIDHDDCISHSEPKDVTVLSVAEEQDLLKQERLVTVDEIGEVEELPLNESADITFATLN
DKGDEGSTVRDSIGFISSQMPEDPSTLVTVDEIQDDGCDLHLVTLDEVTEEDEDSLADFN
NLKEELNFVTVDEVGEEEDGDNDLKVELAQSKNDCPTDKKGDRKKRTVDTQKTDLETLSQ
VGLVNENVVEEDLKTTIERHLAAKTPMKRVRLGKTPPSEKATEPGEYEEAFQIIEASEES
DLKDLEPDRKRKKIEDSSSGKSMTSDVPEDLDFLVPKAGFFCPICSLFYSGEKAMTNHCK
STRHKQNTEKFMAKQRKEKEQNEAEERSSR
Download sequence
Identical sequences ENSCPOP00000009071 10141.ENSCPOP00000009071 ENSCPOP00000009071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]