SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000009791 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000009791
Domain Number 1 Region: 496-541
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000288
Family TSP-1 type 1 repeat 0.00078
Further Details:      
 
Domain Number 2 Region: 70-102
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000101
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 9-57
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000249
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000009791
Domain Number - Region: 450-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0049
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000009791
Sequence length 541
Comment (Cavia porcellus)
Sequence
SRAVTPAAVSCQLSNWSEWTDCFPCQDRKYRYRSLLQPDKFGGAICSGDIWDQASCNSPT
PCLRQPQCGQDFQCKETGRCLKRYLVCNGHSDCLDGSDEDNCEDIRAAEDDCSQYEPIPG
SEKVALGYNILTQREAQSVYDARYYGGQCEPVYNDEKYFRKPYNFLKYHFEAMADTGMSS
ELYEDVNDLLSKIKNDRFQSNGITVGIGLEKFLKGLSSVNVGVSWSEDSSFLNKLSKYNE
KKYSFMRIFTKVQTASFKMRRHKIMLDEGMLQSLMELPEQYDYGMYSKFIDDYGTHYITS
GSMGGTYEYILVLDKAKMESLGITSENTKKCLGGSLGIEFGYKINVEARLSGESCKTSGP
GNSGKEAKKAMGVEDIIVRVRGGSAGEAGGLTQGSSTITYRSWGRSLKYNPVVIDFEVQP
IYEVLKHADLGPLEVKRQNLRRAWDQYLMEFNACRCGPCFNNGVAILEGTSCRCQCGQGR
HGPACEHMEREGAKADGRWSCWSSWSECRAGTQERRRACDNPAPQNGGAPCPGHSVQTRA
C
Download sequence
Identical sequences ENSCPOP00000009791 ENSCPOP00000009791 10141.ENSCPOP00000009791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]