SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000010268 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000010268
Domain Number 1 Region: 472-718
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.24e-52
Family Eukaryotic proteases 0.0000525
Further Details:      
 
Domain Number 2 Region: 377-467
Classification Level Classification E-value
Superfamily Kringle-like 1.04e-33
Family Kringle modules 0.00012
Further Details:      
 
Domain Number 3 Region: 189-273
Classification Level Classification E-value
Superfamily Kringle-like 1.18e-33
Family Kringle modules 0.00015
Further Details:      
 
Domain Number 4 Region: 289-374
Classification Level Classification E-value
Superfamily Kringle-like 2.01e-30
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 5 Region: 96-187
Classification Level Classification E-value
Superfamily Kringle-like 4.11e-30
Family Kringle modules 0.00037
Further Details:      
 
Domain Number 6 Region: 20-106
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 4.12e-19
Family Hairpin loop containing domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000010268
Sequence length 720
Comment (Cavia porcellus)
Sequence
MGWLLLLLLLTRILEAPGQRSPLNDFQVLRGTELQHLLHEVAGSWQKVVGDAEECAKHCG
ARLDCRAFHYNMSSLSCQLLPWTQHSPHTRLRRSASCDLFQKKDYVRTCIMDNGVRYRGI
VAKTVDGLLCQSWNHKFPNDHKYKPTLRNGLEENFCRNPDGDLGGPWCYTTDPTVRFQSC
GIKSCREAACIWCNGEDYRGSVDHTESGRECQRWDLQHPHVHPFEPDKFLDKDLDDNYCR
NPDGSERPWCYTTDPKLEREFCNLPRCASGSDLAWSTPGSEVQPHQEATTFHCFRGKGEG
YRGTANTTTAGVPCQRWEAQSPHQHRFLPEKYACKDLRENFCRNPDGSEAPWCFTTRPGM
RVAFCYQIPRCTEEVGTEDCYNGSGEQYRGSVNKTRKGVPCQHWSAETPHKPQFTPTSAP
YAQLKENFCRNPDGDSHGPWCYTTDPGTSFDYCALRRCNDDPPVSILDPPDQVEFEKCGK
KLDRPHQWLSKLRIVGGHPGNSPWTVSLRNRQGQHFCSGSLVKEQWVLTARQCFPSCHAP
LTGYEVWLGTMFQNPQPEEPGLQQIPVAKIVCGPSDSQLVLHSCSRPVTLNLRVALICLP
PERYVVPPATMCEITGWGEARGLSHRVLNVASLNVISNQECNIKHRGRVRENEMCTRALM
VPVGACEGDYGGPLACFTHDCWVLEGIIIPNRVCARPGWPAIFLRVSVFVDWIHKVIQLG
Download sequence
Identical sequences 10141.ENSCPOP00000010268 ENSCPOP00000010268 ENSCPOP00000010268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]