SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000010900 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000010900
Domain Number 1 Region: 12-336,452-497
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.12e-62
Family FAD-linked reductases, N-terminal domain 0.004
Further Details:      
 
Domain Number 2 Region: 316-439
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.3e-29
Family L-aminoacid/polyamine oxidase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000010900
Sequence length 511
Comment (Cavia porcellus)
Sequence
SGSGGGGCEFSSSPRVLVIGGGIAGLGAAQRLCHYSAAPHLSVLEATARAGGRIHSRRGF
GGVVEMGAHWIHGPSQGNPVFQLAAAFGLLGEKELSEENQRVETGGHLDLRSICCTSSGT
RVSLELVAEMASLFYGLIDQTREFLHVPETPVPSVGEYLKKEIGQQVAHWTEDAETKKLK
LAILNNFFNTECCISGTHSMDLVALAPFGEYTVLPGLDCTFSGGYQELTNHIMASLPKDV
IVFNKPVKTIHWNGSFQEAAFPGETFPVLAECDDGSRFPAHHVIITVPLGFLKEHQDTFF
EPPLPAEKVEAIRKIGFGTNNKVFLEFEEPFWESDCQFIQVVWEDTSPLQDTASGLQDTW
FKKLIGFLVLPSFKSVHVLCGFIAGLESEFMETLSDEEVLLSLTQVLRRVTGNPRLPAPK
SVLRSCWHSSPYTRGSYSYVAVGSTGDDIDLLAQPLPSDGTSPQLQVLFAGEATHRTFYS
TTHGALLSGWREADRLMGLWDLKMQQPRPRL
Download sequence
Identical sequences ENSCPOP00000010900 ENSCPOP00000010900 10141.ENSCPOP00000010900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]