SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000010918 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10141.ENSCPOP00000010918
Domain Number - Region: 1170-1192,1253-1309
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0144
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000010918
Sequence length 1333
Comment (Cavia porcellus)
Sequence
MFLMPTSSELNSGQNFLTQWMTNPSRAGVILNRGFPILEADEEKQTATNTSTFLSKTTRF
SNSFSFSSEEDSLHEELKLESSSPHKLQSQKSEASGILPLIKKKPQIVACQNTPGNQKDN
KSDFMPSFDGDFKDVFYKDPLFKKLEQLKEVQQRKQEQLRRQQSEQLQRFLEEQEKLLTV
VSGQRVLPGFTLLPDDDSQKYRSPGSTPAREKATPFLPSYVYPNQTQEKLHSSNISFDEQ
NNLCKATPHDFVPASKRSSPNLFFESQYQEAIVKKYDLKEDNPIGESILPLEKTTEQIQE
RNDTNCDSSEVVNIEVRPIKAVIRERKQTFEDYLEEQIQLDEQALKQKQLREAEGQLKAK
PKQPFLKRGEGLARFINNKSKLQKGKESKLGTNQNALEDQSLFKVDRQLFQRKTALINKE
PCSENCTVKKENKTRTKFGSVTHNQKPKVPKSNSRKNVSPSGSKIQTEKKCNGQFREQIK
FDSNKENVPECTKPCDAGCSVWNKTRGKDRPCLPTGPVGCLASKSPTSETGKELVSSFDI
SFQKKLENWEQEKEKENLELDEFLFLEKAAEEISFSSNSSFVLKILERDQQAHKGHRMSS
TPVKAVQQETHLVDLSAKRDCNEDPDPSPACENKSECEVRAGPLASASLPDELKELSCKI
NGKTFQTGSCEGQMLWNVSDGESVRNSDSSTDSEEQLDVTIKPPMEDREGGFISKEDSPQ
ICHGKGPFRDTRTQDNRRDVDLDLSDKDYSSDESVVTEGMKTKVSEPSRRPLLPSVSQID
FDDERSWTDPEENSCKNDVNLGDEVFYGVPHVGYSNSGVCFLDKTIKRKVVPVMKGEVLS
QANRSTSPPPTSDLMMQFFPSLKLQSESDSHLGNEPKLNMSQDQPSGDNARSQALREKVV
ELDTEIEKFKAENASLAKLRMEQESAMEKLRKETADFEQQKVKELARIEDLKKEEMRKLQ
KERKVFEKYATAARTFPDKKEREEIQALKQQIEDLQEDLKKKETKWSSTYGRLRSQIEML
VRENTDLREEIKVMERFRLDAWKKAEAIESSPKAYQCVTARKRDESLNTSVRYQKSHISS
GTQGEKYKKNCLPKHGNPSRRSKSVPPQELGSSDKEQAALPREPFKPISLLDPEYRKEKN
QEIQEEISHPDGKVVEKIYKNGYQIILFPNGTQKEVSADGKSITVTFFNGDVKQVMPDGR
VIYYYAAAQTTHTTHPEGLEVLHFSSGQIEKHFPDGRKEITFPDQTIKNLFADGQEESIF
PDGTVVRVQRDGEKIIEFNNGQRELHTAQFKRREYPDGTVKTVYANGHQETKYTSGRVRV
KDKDGNVLMDTEL
Download sequence
Identical sequences ENSCPOP00000010918 ENSCPOP00000010918 10141.ENSCPOP00000010918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]